Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DU64

Protein Details
Accession A5DU64    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-37LLKNKTQKVTKGKHTSKKNTASVHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 11
Family & Domain DBs
KEGG lel:LELG_00900  -  
Amino Acid Sequences MAGYKLKLDNTSKPLLKNKTQKVTKGKHTSKKNTASVTSATSLSSAKSHAKAKANKSKLGRLNADINGFDEIRGLVVQEPMTKITKDKLKTLDSIKDDYIKDEEKKKITKLANEEMEKQLEVLTGIGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.58
3 0.62
4 0.65
5 0.68
6 0.7
7 0.73
8 0.75
9 0.77
10 0.77
11 0.79
12 0.8
13 0.8
14 0.78
15 0.83
16 0.84
17 0.84
18 0.84
19 0.8
20 0.73
21 0.65
22 0.59
23 0.5
24 0.43
25 0.35
26 0.27
27 0.21
28 0.17
29 0.15
30 0.13
31 0.11
32 0.11
33 0.12
34 0.15
35 0.19
36 0.24
37 0.32
38 0.38
39 0.46
40 0.54
41 0.55
42 0.57
43 0.57
44 0.59
45 0.57
46 0.56
47 0.49
48 0.41
49 0.42
50 0.38
51 0.36
52 0.28
53 0.23
54 0.19
55 0.16
56 0.13
57 0.09
58 0.07
59 0.06
60 0.06
61 0.05
62 0.04
63 0.06
64 0.06
65 0.07
66 0.08
67 0.1
68 0.12
69 0.12
70 0.12
71 0.17
72 0.23
73 0.24
74 0.29
75 0.33
76 0.34
77 0.38
78 0.42
79 0.44
80 0.41
81 0.42
82 0.38
83 0.38
84 0.35
85 0.33
86 0.32
87 0.3
88 0.31
89 0.35
90 0.4
91 0.41
92 0.46
93 0.46
94 0.51
95 0.51
96 0.54
97 0.55
98 0.58
99 0.6
100 0.59
101 0.61
102 0.56
103 0.53
104 0.45
105 0.37
106 0.28
107 0.2
108 0.17