Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8CQZ4

Protein Details
Accession A0A4Y8CQZ4    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
69-91TSFYREEEKREEKKREEKKREREBasic
NLS Segment(s)
PositionSequence
77-91KREEKKREEKKRERE
Subcellular Location(s) nucl 20, mito 5
Family & Domain DBs
Amino Acid Sequences MSVKSVVSKQTSTHAKQAQLDGGEYETNHRVQNKSRGWTRLHGIDGWMSGKRDLDLDLDVKMDALHTMTSFYREEEKREEKKREEKKRERE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.46
3 0.48
4 0.49
5 0.44
6 0.37
7 0.34
8 0.26
9 0.22
10 0.19
11 0.15
12 0.16
13 0.14
14 0.14
15 0.16
16 0.18
17 0.19
18 0.23
19 0.33
20 0.35
21 0.4
22 0.43
23 0.46
24 0.46
25 0.47
26 0.45
27 0.39
28 0.35
29 0.29
30 0.24
31 0.2
32 0.18
33 0.15
34 0.14
35 0.1
36 0.09
37 0.09
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.09
44 0.09
45 0.1
46 0.09
47 0.09
48 0.08
49 0.06
50 0.05
51 0.05
52 0.05
53 0.05
54 0.07
55 0.07
56 0.1
57 0.11
58 0.12
59 0.2
60 0.21
61 0.25
62 0.32
63 0.41
64 0.48
65 0.57
66 0.64
67 0.64
68 0.74
69 0.8
70 0.83
71 0.85