Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5E6L6

Protein Details
Accession A5E6L6    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
135-157IVAARPSYKKLLKKQKEREPKWFHydrophilic
NLS Segment(s)
PositionSequence
138-155ARPSYKKLLKKQKEREPK
Subcellular Location(s) nucl 11.5, mito_nucl 11.166, cyto_nucl 9.833, mito 9.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
KEGG lel:LELG_05255  -  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MSSLTAKEAFAKLPQKLHNFFIKYPPRPFAQYKDGPSLTTDPDMNPFYHTKNPDTGKWRGAPISRRRSADLFKMAKKFGIEDLLPPVPRKFYEEKYDNKKWMLGMTHPASAVSKPEIEEKLRKRAEAIKNMDKIIVAARPSYKKLLKKQKEREPKWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.47
3 0.49
4 0.52
5 0.53
6 0.51
7 0.5
8 0.53
9 0.56
10 0.55
11 0.57
12 0.55
13 0.5
14 0.52
15 0.54
16 0.5
17 0.5
18 0.5
19 0.49
20 0.54
21 0.51
22 0.46
23 0.44
24 0.4
25 0.33
26 0.28
27 0.24
28 0.16
29 0.2
30 0.21
31 0.19
32 0.19
33 0.19
34 0.2
35 0.25
36 0.27
37 0.25
38 0.31
39 0.34
40 0.36
41 0.4
42 0.4
43 0.39
44 0.38
45 0.37
46 0.34
47 0.35
48 0.38
49 0.43
50 0.49
51 0.5
52 0.49
53 0.5
54 0.5
55 0.48
56 0.45
57 0.45
58 0.39
59 0.39
60 0.4
61 0.37
62 0.35
63 0.32
64 0.27
65 0.19
66 0.17
67 0.13
68 0.11
69 0.15
70 0.16
71 0.16
72 0.16
73 0.16
74 0.14
75 0.14
76 0.18
77 0.19
78 0.21
79 0.29
80 0.33
81 0.41
82 0.49
83 0.54
84 0.52
85 0.48
86 0.46
87 0.37
88 0.35
89 0.3
90 0.23
91 0.25
92 0.24
93 0.25
94 0.23
95 0.23
96 0.21
97 0.19
98 0.19
99 0.13
100 0.12
101 0.12
102 0.16
103 0.19
104 0.22
105 0.31
106 0.33
107 0.42
108 0.43
109 0.42
110 0.41
111 0.48
112 0.53
113 0.54
114 0.57
115 0.56
116 0.57
117 0.58
118 0.55
119 0.45
120 0.37
121 0.3
122 0.25
123 0.17
124 0.17
125 0.22
126 0.26
127 0.29
128 0.37
129 0.41
130 0.46
131 0.56
132 0.64
133 0.69
134 0.76
135 0.83
136 0.86
137 0.91