Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8CYC0

Protein Details
Accession A0A4Y8CYC0   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
3-25PKPFNPPRPSGQSKPRGRPKGTTHydrophilic
NLS Segment(s)
PositionSequence
16-21KPRGRP
Subcellular Location(s) nucl 19, cyto_nucl 12.5, mito 4, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR018552  CENP-X  
IPR009072  Histone-fold  
Gene Ontology GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0006281  P:DNA repair  
GO:0051382  P:kinetochore assembly  
Pfam View protein in Pfam  
PF09415  CENP-X  
Amino Acid Sequences MPPKPFNPPRPSGQSKPRGRPKGTTSTSTTSKPKPTVKSAVSQQPRVSKTPTPQLEDSDSSSELETDKNDEMEVDENSDDPFASQPTISKGKAKASTSTSASTTKPSISKAKDNGDPQSSDSELEMISSPRRAARNTASTSTHQNPAEESDSDSETRTTIPNDLLSKIMHELFAEPNTRISKEANKAAGKYMDTFVREAIARVRYAERGSGRGGGFWEVEDLEKMAPQLLLDF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.77
3 0.82
4 0.85
5 0.84
6 0.8
7 0.8
8 0.77
9 0.78
10 0.73
11 0.67
12 0.63
13 0.6
14 0.6
15 0.57
16 0.56
17 0.51
18 0.53
19 0.55
20 0.57
21 0.57
22 0.6
23 0.64
24 0.6
25 0.61
26 0.61
27 0.63
28 0.62
29 0.61
30 0.58
31 0.57
32 0.58
33 0.53
34 0.51
35 0.46
36 0.46
37 0.51
38 0.51
39 0.49
40 0.47
41 0.47
42 0.47
43 0.44
44 0.41
45 0.34
46 0.29
47 0.24
48 0.22
49 0.19
50 0.15
51 0.13
52 0.11
53 0.11
54 0.11
55 0.11
56 0.11
57 0.1
58 0.11
59 0.12
60 0.12
61 0.1
62 0.09
63 0.09
64 0.1
65 0.1
66 0.08
67 0.06
68 0.07
69 0.06
70 0.06
71 0.06
72 0.07
73 0.12
74 0.16
75 0.16
76 0.2
77 0.22
78 0.27
79 0.33
80 0.33
81 0.33
82 0.33
83 0.36
84 0.34
85 0.33
86 0.29
87 0.26
88 0.25
89 0.23
90 0.2
91 0.18
92 0.17
93 0.18
94 0.23
95 0.24
96 0.29
97 0.32
98 0.35
99 0.38
100 0.4
101 0.4
102 0.35
103 0.33
104 0.28
105 0.26
106 0.21
107 0.17
108 0.14
109 0.11
110 0.09
111 0.09
112 0.08
113 0.07
114 0.07
115 0.07
116 0.08
117 0.11
118 0.13
119 0.13
120 0.16
121 0.21
122 0.28
123 0.31
124 0.34
125 0.33
126 0.34
127 0.39
128 0.38
129 0.38
130 0.31
131 0.28
132 0.25
133 0.26
134 0.27
135 0.21
136 0.19
137 0.16
138 0.17
139 0.17
140 0.17
141 0.14
142 0.11
143 0.12
144 0.12
145 0.11
146 0.11
147 0.12
148 0.15
149 0.16
150 0.17
151 0.17
152 0.16
153 0.16
154 0.16
155 0.16
156 0.12
157 0.11
158 0.12
159 0.12
160 0.15
161 0.16
162 0.14
163 0.19
164 0.21
165 0.21
166 0.21
167 0.21
168 0.27
169 0.31
170 0.37
171 0.39
172 0.4
173 0.4
174 0.43
175 0.44
176 0.37
177 0.33
178 0.3
179 0.26
180 0.25
181 0.24
182 0.2
183 0.2
184 0.19
185 0.17
186 0.2
187 0.19
188 0.18
189 0.2
190 0.22
191 0.23
192 0.24
193 0.3
194 0.27
195 0.27
196 0.28
197 0.31
198 0.29
199 0.27
200 0.27
201 0.23
202 0.21
203 0.18
204 0.18
205 0.13
206 0.13
207 0.13
208 0.13
209 0.11
210 0.11
211 0.11
212 0.11
213 0.1