Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8CJP1

Protein Details
Accession A0A4Y8CJP1   
Localization Confidence High
Confidence Score 18.6
NoLS Segment(s)
PositionSequenceProtein Nature
17-41ASYRIVKPYSLRRKLRKGQSNPGMTHydrophilic
56-89MEEKGREEEKRRREKKKRKEEEKRKEEEKRRISKBasic
94-121IAPNHHFPKEERKKIHKCKKGYHEYVSEBasic
NLS Segment(s)
PositionSequence
28-110RRKLRKGQSNPGMTLRLQIRRQRREEQKMEEKGREEEKRRREKKKRKEEEKRKEEEKRRISKNPVSIAPNHHFPKEERKKIHK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, mito 4
Family & Domain DBs
Amino Acid Sequences MNPQIHNPATEAATATASYRIVKPYSLRRKLRKGQSNPGMTLRLQIRRQRREEQKMEEKGREEEKRRREKKKRKEEEKRKEEEKRRISKNPVSIAPNHHFPKEERKKIHKCKKGYHEYVSENRANRTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.13
3 0.12
4 0.12
5 0.13
6 0.13
7 0.16
8 0.16
9 0.18
10 0.22
11 0.32
12 0.42
13 0.5
14 0.58
15 0.64
16 0.73
17 0.8
18 0.85
19 0.85
20 0.82
21 0.83
22 0.83
23 0.79
24 0.71
25 0.65
26 0.56
27 0.46
28 0.43
29 0.37
30 0.34
31 0.35
32 0.39
33 0.46
34 0.52
35 0.57
36 0.62
37 0.67
38 0.7
39 0.7
40 0.72
41 0.72
42 0.72
43 0.7
44 0.63
45 0.55
46 0.49
47 0.49
48 0.46
49 0.44
50 0.43
51 0.49
52 0.57
53 0.64
54 0.72
55 0.76
56 0.81
57 0.85
58 0.89
59 0.9
60 0.91
61 0.94
62 0.95
63 0.95
64 0.94
65 0.9
66 0.87
67 0.86
68 0.84
69 0.83
70 0.82
71 0.8
72 0.77
73 0.77
74 0.77
75 0.74
76 0.72
77 0.67
78 0.62
79 0.56
80 0.51
81 0.51
82 0.47
83 0.49
84 0.44
85 0.39
86 0.37
87 0.36
88 0.44
89 0.48
90 0.53
91 0.54
92 0.62
93 0.72
94 0.81
95 0.9
96 0.87
97 0.84
98 0.85
99 0.87
100 0.88
101 0.85
102 0.81
103 0.78
104 0.77
105 0.76
106 0.72
107 0.67
108 0.59