Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A5DVC5

Protein Details
Accession A5DVC5    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
15-38RAIFQLKQQRDKIKQYQRKLSLIRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 13, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR005024  Snf7_fam  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0043231  C:intracellular membrane-bounded organelle  
GO:0045324  P:late endosome to vacuole transport  
KEGG lel:LELG_01311  -  
Pfam View protein in Pfam  
PF03357  Snf7  
Amino Acid Sequences MGNQPSAPKITAEDRAIFQLKQQRDKIKQYQRKLSLIRDKQTKLAKKAILNKQPDRAKLYLRLKKQQEATITKTYDQLDNLEKLIGTIEFKLIEKDVMYGLQQGNAVLKQLNAEMNVDKIDKIMDDLEEERLQEQEISQTLGLGSGLSRVDEDAVDDEFERLNKEINKTSAIKQEETKEEQKVVGELPSAPKDQIMPNVPSDTPLSDKKENQNAELEKEKPKQEQSESEPIAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.37
4 0.33
5 0.34
6 0.36
7 0.39
8 0.45
9 0.5
10 0.54
11 0.59
12 0.69
13 0.74
14 0.77
15 0.8
16 0.81
17 0.84
18 0.81
19 0.82
20 0.77
21 0.77
22 0.76
23 0.75
24 0.74
25 0.72
26 0.67
27 0.65
28 0.7
29 0.68
30 0.63
31 0.63
32 0.6
33 0.58
34 0.66
35 0.69
36 0.68
37 0.68
38 0.67
39 0.68
40 0.68
41 0.66
42 0.61
43 0.54
44 0.5
45 0.51
46 0.57
47 0.55
48 0.56
49 0.61
50 0.6
51 0.64
52 0.64
53 0.59
54 0.57
55 0.55
56 0.54
57 0.52
58 0.49
59 0.44
60 0.43
61 0.39
62 0.33
63 0.28
64 0.24
65 0.2
66 0.2
67 0.19
68 0.16
69 0.14
70 0.12
71 0.12
72 0.1
73 0.07
74 0.07
75 0.07
76 0.07
77 0.08
78 0.08
79 0.08
80 0.08
81 0.07
82 0.08
83 0.07
84 0.07
85 0.07
86 0.09
87 0.09
88 0.1
89 0.09
90 0.09
91 0.09
92 0.09
93 0.09
94 0.07
95 0.06
96 0.06
97 0.07
98 0.07
99 0.07
100 0.08
101 0.07
102 0.08
103 0.09
104 0.08
105 0.07
106 0.07
107 0.06
108 0.05
109 0.06
110 0.06
111 0.05
112 0.06
113 0.07
114 0.1
115 0.1
116 0.1
117 0.1
118 0.09
119 0.09
120 0.08
121 0.07
122 0.07
123 0.07
124 0.08
125 0.07
126 0.07
127 0.07
128 0.07
129 0.07
130 0.05
131 0.04
132 0.05
133 0.05
134 0.05
135 0.05
136 0.05
137 0.06
138 0.06
139 0.06
140 0.06
141 0.06
142 0.07
143 0.07
144 0.08
145 0.08
146 0.08
147 0.09
148 0.08
149 0.12
150 0.15
151 0.18
152 0.22
153 0.24
154 0.28
155 0.3
156 0.33
157 0.37
158 0.37
159 0.36
160 0.35
161 0.39
162 0.4
163 0.44
164 0.44
165 0.38
166 0.36
167 0.35
168 0.32
169 0.27
170 0.22
171 0.17
172 0.14
173 0.13
174 0.17
175 0.19
176 0.19
177 0.18
178 0.18
179 0.19
180 0.2
181 0.26
182 0.26
183 0.26
184 0.27
185 0.3
186 0.3
187 0.29
188 0.29
189 0.24
190 0.23
191 0.27
192 0.31
193 0.34
194 0.4
195 0.47
196 0.54
197 0.54
198 0.52
199 0.55
200 0.51
201 0.51
202 0.51
203 0.46
204 0.46
205 0.5
206 0.52
207 0.5
208 0.54
209 0.56
210 0.56
211 0.61
212 0.61
213 0.65