Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8D6M6

Protein Details
Accession A0A4Y8D6M6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
15-34TTPTLPTKRKPIPNPKATPWHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 7.5, mito 4
Family & Domain DBs
Amino Acid Sequences MPLAKDRRFENHCGTTPTLPTKRKPIPNPKATPWDRNRCHISYAKEAPRSPAVSSTIPMAKVDCVPNLRVQLVATGAVRRAKEMDKPPTNAYSREVAPGKVSLAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.49
3 0.48
4 0.51
5 0.51
6 0.47
7 0.47
8 0.51
9 0.57
10 0.63
11 0.69
12 0.71
13 0.73
14 0.79
15 0.82
16 0.78
17 0.79
18 0.74
19 0.74
20 0.72
21 0.72
22 0.65
23 0.65
24 0.65
25 0.56
26 0.56
27 0.52
28 0.47
29 0.44
30 0.49
31 0.48
32 0.47
33 0.46
34 0.44
35 0.42
36 0.38
37 0.31
38 0.26
39 0.23
40 0.19
41 0.19
42 0.18
43 0.16
44 0.15
45 0.14
46 0.12
47 0.1
48 0.12
49 0.13
50 0.13
51 0.13
52 0.14
53 0.17
54 0.18
55 0.18
56 0.16
57 0.15
58 0.13
59 0.12
60 0.13
61 0.1
62 0.1
63 0.12
64 0.15
65 0.15
66 0.15
67 0.17
68 0.18
69 0.25
70 0.33
71 0.41
72 0.44
73 0.48
74 0.51
75 0.56
76 0.56
77 0.5
78 0.45
79 0.39
80 0.34
81 0.37
82 0.36
83 0.29
84 0.29
85 0.28