Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8D3J1

Protein Details
Accession A0A4Y8D3J1    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
40-92EEEKRRREEEKKRRREEEKKRRREEEKKRRREEEKKREKRRGKNQDEIRRKIGBasic
NLS Segment(s)
PositionSequence
4-86KEKEKEKEKEKEKEMLVVRRHLDAPRYERTNEKRRGEEEKRRREEEKKRRREEEKKRRREEEKKRRREEEKKREKRRGKNQDE
Subcellular Location(s) nucl 19, cyto_nucl 11.5, mito 3, cyto 2, plas 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MKEKEKEKEKEKEKEKEMLVVRRHLDAPRYERTNEKRRGEEEKRRREEEKKRRREEEKKRRREEEKKRRREEEKKREKRRGKNQDEIRRKIGIFFFSFFFLIFLLIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.69
3 0.67
4 0.64
5 0.62
6 0.57
7 0.53
8 0.5
9 0.45
10 0.46
11 0.4
12 0.37
13 0.35
14 0.37
15 0.38
16 0.4
17 0.39
18 0.45
19 0.51
20 0.57
21 0.59
22 0.59
23 0.56
24 0.56
25 0.64
26 0.65
27 0.68
28 0.68
29 0.7
30 0.71
31 0.71
32 0.71
33 0.71
34 0.73
35 0.73
36 0.73
37 0.73
38 0.74
39 0.77
40 0.82
41 0.83
42 0.83
43 0.84
44 0.84
45 0.84
46 0.84
47 0.84
48 0.84
49 0.84
50 0.84
51 0.84
52 0.84
53 0.84
54 0.84
55 0.84
56 0.84
57 0.84
58 0.84
59 0.84
60 0.84
61 0.84
62 0.88
63 0.92
64 0.92
65 0.92
66 0.92
67 0.92
68 0.89
69 0.89
70 0.89
71 0.89
72 0.89
73 0.85
74 0.78
75 0.71
76 0.63
77 0.57
78 0.5
79 0.44
80 0.37
81 0.33
82 0.29
83 0.27
84 0.27
85 0.22
86 0.19
87 0.13