Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8DBJ7

Protein Details
Accession A0A4Y8DBJ7   
Localization Confidence Medium
Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
76-106FATKIEKASRQQRKQRKNRQKTLRGTAKVKGHydrophilic
NLS Segment(s)
PositionSequence
82-112KASRQQRKQRKNRQKTLRGTAKVKGAKKKKE
Subcellular Location(s) mito 15, nucl 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADNNAPVTLRTRKFIRNPLLGRKQMVVDILHPNLNVFGLRTQFGGGKTTGFALVYDSPEALKKFEPHYRLFRVGFATKIEKASRQQRKQRKNRQKTLRGTAKVKGAKKKKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.57
3 0.6
4 0.61
5 0.65
6 0.71
7 0.75
8 0.7
9 0.65
10 0.57
11 0.49
12 0.41
13 0.37
14 0.27
15 0.21
16 0.22
17 0.22
18 0.21
19 0.2
20 0.18
21 0.16
22 0.15
23 0.12
24 0.08
25 0.08
26 0.08
27 0.09
28 0.09
29 0.1
30 0.11
31 0.12
32 0.13
33 0.11
34 0.1
35 0.1
36 0.1
37 0.1
38 0.08
39 0.07
40 0.07
41 0.08
42 0.08
43 0.08
44 0.08
45 0.08
46 0.1
47 0.1
48 0.09
49 0.1
50 0.11
51 0.15
52 0.2
53 0.24
54 0.27
55 0.33
56 0.37
57 0.41
58 0.39
59 0.37
60 0.37
61 0.34
62 0.31
63 0.27
64 0.26
65 0.23
66 0.26
67 0.25
68 0.24
69 0.3
70 0.39
71 0.47
72 0.53
73 0.62
74 0.69
75 0.79
76 0.86
77 0.91
78 0.92
79 0.92
80 0.93
81 0.94
82 0.94
83 0.92
84 0.92
85 0.91
86 0.87
87 0.8
88 0.75
89 0.73
90 0.71
91 0.69
92 0.69