Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8DI40

Protein Details
Accession A0A4Y8DI40    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MTFACKKCKKAFRKDFADETDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 12.5, cyto 9.5
Family & Domain DBs
Amino Acid Sequences MTFACKKCKKAFRKDFADETDDGDEYCPHCDNHYVIDAIEPKPMLKFEGEDIRKDSRMIKDDRLQGKEQRTIFDVEEAPNKLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.8
3 0.75
4 0.69
5 0.58
6 0.5
7 0.42
8 0.32
9 0.26
10 0.2
11 0.17
12 0.13
13 0.14
14 0.12
15 0.1
16 0.11
17 0.13
18 0.13
19 0.14
20 0.15
21 0.14
22 0.12
23 0.15
24 0.16
25 0.15
26 0.15
27 0.13
28 0.11
29 0.11
30 0.11
31 0.09
32 0.07
33 0.07
34 0.09
35 0.19
36 0.2
37 0.21
38 0.25
39 0.27
40 0.27
41 0.27
42 0.29
43 0.26
44 0.31
45 0.33
46 0.36
47 0.4
48 0.48
49 0.54
50 0.55
51 0.53
52 0.53
53 0.55
54 0.56
55 0.5
56 0.44
57 0.4
58 0.38
59 0.35
60 0.33
61 0.29
62 0.25
63 0.3