Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8DFK5

Protein Details
Accession A0A4Y8DFK5    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
35-58LKKPNRAVTRRKAANKNRHKGTKKBasic
NLS Segment(s)
PositionSequence
36-59KKPNRAVTRRKAANKNRHKGTKKE
Subcellular Location(s) nucl 23, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MAIHQTQSSTHRPTNSNVKSTDDKGLETNTKVQSLKKPNRAVTRRKAANKNRHKGTKKEYLRDAFKYAHAQIPKNKPKRDDYKSEEEYNIDMKNYNNVREAARKKAEASGNKGEQQNSSGRRTEQAPKPNQKLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.54
3 0.53
4 0.48
5 0.5
6 0.49
7 0.49
8 0.51
9 0.41
10 0.36
11 0.32
12 0.36
13 0.33
14 0.3
15 0.33
16 0.28
17 0.3
18 0.3
19 0.32
20 0.36
21 0.44
22 0.51
23 0.54
24 0.59
25 0.63
26 0.72
27 0.77
28 0.77
29 0.75
30 0.76
31 0.75
32 0.77
33 0.8
34 0.79
35 0.82
36 0.84
37 0.83
38 0.81
39 0.83
40 0.79
41 0.76
42 0.73
43 0.73
44 0.69
45 0.66
46 0.64
47 0.6
48 0.6
49 0.56
50 0.52
51 0.42
52 0.37
53 0.34
54 0.29
55 0.27
56 0.24
57 0.25
58 0.29
59 0.38
60 0.46
61 0.51
62 0.53
63 0.53
64 0.59
65 0.66
66 0.65
67 0.63
68 0.61
69 0.63
70 0.64
71 0.63
72 0.55
73 0.46
74 0.41
75 0.34
76 0.28
77 0.18
78 0.15
79 0.12
80 0.2
81 0.21
82 0.22
83 0.22
84 0.23
85 0.25
86 0.33
87 0.37
88 0.37
89 0.4
90 0.39
91 0.38
92 0.43
93 0.48
94 0.45
95 0.49
96 0.5
97 0.5
98 0.53
99 0.55
100 0.49
101 0.43
102 0.4
103 0.41
104 0.37
105 0.37
106 0.35
107 0.34
108 0.35
109 0.39
110 0.46
111 0.46
112 0.52
113 0.58
114 0.64