Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8D635

Protein Details
Accession A0A4Y8D635    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
72-93GPIGKPKKPKENPNMDKRQRRIBasic
NLS Segment(s)
PositionSequence
76-84KPKKPKENP
Subcellular Location(s) nucl 16, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR020993  Centromere_CenpK  
Gene Ontology GO:0000775  C:chromosome, centromeric region  
GO:0005634  C:nucleus  
GO:0051382  P:kinetochore assembly  
Amino Acid Sequences MHSALQTRISALTTQLTQQTQKSPSQIFSELQSSFQAGKTHYDTETGNLIRAFNTFIDSHLAPMLAAEELGGPIGKPKKPKENPNMDKRQRRIDEIWGPKPSLDQDEDEDEEEEEWDETRAAAAEMRELAEQLLNGLLEADETGSDGYVTLERDSAAARFLVRSKVAQYHFKDARKLKLVDFEKDIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.21
3 0.23
4 0.24
5 0.26
6 0.31
7 0.32
8 0.35
9 0.38
10 0.36
11 0.36
12 0.38
13 0.38
14 0.32
15 0.31
16 0.33
17 0.28
18 0.26
19 0.24
20 0.21
21 0.19
22 0.2
23 0.2
24 0.16
25 0.2
26 0.23
27 0.24
28 0.23
29 0.24
30 0.21
31 0.21
32 0.26
33 0.22
34 0.2
35 0.18
36 0.18
37 0.17
38 0.17
39 0.16
40 0.1
41 0.12
42 0.1
43 0.1
44 0.14
45 0.14
46 0.14
47 0.13
48 0.12
49 0.09
50 0.09
51 0.09
52 0.05
53 0.05
54 0.04
55 0.03
56 0.03
57 0.04
58 0.04
59 0.03
60 0.07
61 0.11
62 0.13
63 0.19
64 0.24
65 0.35
66 0.42
67 0.52
68 0.58
69 0.66
70 0.72
71 0.76
72 0.83
73 0.81
74 0.82
75 0.75
76 0.75
77 0.65
78 0.62
79 0.54
80 0.5
81 0.51
82 0.5
83 0.52
84 0.44
85 0.42
86 0.37
87 0.35
88 0.29
89 0.23
90 0.17
91 0.13
92 0.13
93 0.16
94 0.17
95 0.17
96 0.16
97 0.14
98 0.12
99 0.11
100 0.09
101 0.07
102 0.06
103 0.06
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.06
110 0.06
111 0.06
112 0.07
113 0.08
114 0.08
115 0.08
116 0.08
117 0.07
118 0.07
119 0.06
120 0.06
121 0.05
122 0.05
123 0.05
124 0.04
125 0.04
126 0.04
127 0.04
128 0.03
129 0.04
130 0.04
131 0.04
132 0.04
133 0.04
134 0.05
135 0.06
136 0.08
137 0.08
138 0.08
139 0.08
140 0.09
141 0.1
142 0.09
143 0.09
144 0.09
145 0.09
146 0.11
147 0.13
148 0.17
149 0.17
150 0.19
151 0.22
152 0.29
153 0.33
154 0.4
155 0.42
156 0.48
157 0.54
158 0.57
159 0.62
160 0.6
161 0.65
162 0.64
163 0.62
164 0.55
165 0.57
166 0.58
167 0.54