Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8CIY4

Protein Details
Accession A0A4Y8CIY4    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
24-49DTFESSKKKILKKFKNKKVKKVEVVEHydrophilic
NLS Segment(s)
PositionSequence
30-44KKKILKKFKNKKVKK
Subcellular Location(s) cyto_nucl 12.5, nucl 12, cyto 11, mito 3
Family & Domain DBs
Amino Acid Sequences MSAPNEIVWLDKLFLFRLNNKVVDTFESSKKKILKKFKNKKVKKVEVVEVVEVVEQVEVQQPTRIIHVRMQITKTCCPICGDHYEVVAQFRERLQAAGGADI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.21
3 0.23
4 0.28
5 0.31
6 0.31
7 0.31
8 0.31
9 0.28
10 0.28
11 0.3
12 0.28
13 0.32
14 0.36
15 0.36
16 0.4
17 0.45
18 0.48
19 0.5
20 0.57
21 0.6
22 0.66
23 0.76
24 0.81
25 0.86
26 0.87
27 0.89
28 0.89
29 0.87
30 0.84
31 0.78
32 0.73
33 0.68
34 0.63
35 0.52
36 0.41
37 0.32
38 0.23
39 0.18
40 0.12
41 0.05
42 0.03
43 0.03
44 0.07
45 0.07
46 0.07
47 0.09
48 0.09
49 0.1
50 0.14
51 0.15
52 0.14
53 0.17
54 0.23
55 0.27
56 0.3
57 0.32
58 0.34
59 0.37
60 0.38
61 0.4
62 0.35
63 0.31
64 0.3
65 0.29
66 0.28
67 0.3
68 0.3
69 0.27
70 0.27
71 0.27
72 0.25
73 0.25
74 0.23
75 0.18
76 0.16
77 0.15
78 0.18
79 0.17
80 0.17
81 0.16
82 0.18