Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8D3H0

Protein Details
Accession A0A4Y8D3H0    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
33-57RSPQHVHARKRCRRGGRRDRHEEGNBasic
NLS Segment(s)
PositionSequence
37-51HVHARKRCRRGGRRD
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, cyto 8.5, mito 3, cysk 3
Family & Domain DBs
Amino Acid Sequences MGNCITRLEAEMVAPPPISGNWQDLGPRKAISRSPQHVHARKRCRRGGRRDRHEEGNSLLLARRETSSGIEGLTFDYAGRPVWRDPKLQIHDSDDCDIAKAEDIEEAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.12
4 0.12
5 0.14
6 0.12
7 0.13
8 0.13
9 0.14
10 0.18
11 0.23
12 0.25
13 0.24
14 0.23
15 0.22
16 0.24
17 0.28
18 0.3
19 0.34
20 0.39
21 0.41
22 0.49
23 0.57
24 0.62
25 0.67
26 0.7
27 0.72
28 0.73
29 0.78
30 0.76
31 0.77
32 0.79
33 0.81
34 0.82
35 0.82
36 0.84
37 0.85
38 0.82
39 0.78
40 0.7
41 0.6
42 0.51
43 0.42
44 0.32
45 0.23
46 0.2
47 0.13
48 0.12
49 0.11
50 0.1
51 0.09
52 0.09
53 0.1
54 0.11
55 0.1
56 0.1
57 0.09
58 0.08
59 0.09
60 0.08
61 0.07
62 0.05
63 0.06
64 0.06
65 0.07
66 0.08
67 0.09
68 0.13
69 0.21
70 0.24
71 0.26
72 0.3
73 0.39
74 0.45
75 0.47
76 0.47
77 0.45
78 0.47
79 0.48
80 0.46
81 0.37
82 0.31
83 0.28
84 0.25
85 0.19
86 0.17
87 0.13
88 0.11