Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8DK70

Protein Details
Accession A0A4Y8DK70   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
208-246IQRLKEERKAKKKAEKADLLELSKKRKKKHVSLNGLTSLHydrophilic
NLS Segment(s)
PositionSequence
210-237RLKEERKAKKKAEKADLLELSKKRKKKH
283-297RKHQGDGGPPRKSQR
Subcellular Location(s) nucl 14.5, mito_nucl 13.5, mito 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019324  MPP6  
Pfam View protein in Pfam  
PF10175  MPP6  
Amino Acid Sequences MSASAGTPTSAPKAMSSRLLTMKFMQRAAASSPTNTSPSSIDEPSPKRQKTAQNTPTKFNVDALSDNRAIQAAIVEEEAKKQAALDRAAVEAGDTRWVLSFEGRKHLNAPTNTLRVVQTGFANLDQPSPIKAERVDDDDNDFGEEKPFMVGRRSFGKFNKVLEKQQNPDIEFTSSEEESDEEESEDEDSEDDPTGAKELIKASKQEAIQRLKEERKAKKKAEKADLLELSKKRKKKHVSLNGLTSLSGSGGGSFGSGGGIKSDIKCYTCGGNHMARDCSNPKRKHQGDGGPPRKSQRTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.32
4 0.35
5 0.39
6 0.41
7 0.4
8 0.41
9 0.47
10 0.44
11 0.41
12 0.37
13 0.31
14 0.32
15 0.33
16 0.34
17 0.27
18 0.25
19 0.27
20 0.27
21 0.29
22 0.27
23 0.24
24 0.19
25 0.23
26 0.26
27 0.25
28 0.25
29 0.32
30 0.36
31 0.45
32 0.53
33 0.49
34 0.48
35 0.53
36 0.6
37 0.61
38 0.68
39 0.68
40 0.69
41 0.71
42 0.72
43 0.71
44 0.65
45 0.55
46 0.46
47 0.39
48 0.3
49 0.31
50 0.29
51 0.28
52 0.25
53 0.24
54 0.22
55 0.2
56 0.17
57 0.13
58 0.12
59 0.07
60 0.07
61 0.07
62 0.08
63 0.08
64 0.09
65 0.1
66 0.09
67 0.08
68 0.08
69 0.12
70 0.16
71 0.17
72 0.18
73 0.18
74 0.18
75 0.18
76 0.17
77 0.14
78 0.1
79 0.09
80 0.09
81 0.08
82 0.08
83 0.08
84 0.09
85 0.09
86 0.11
87 0.16
88 0.16
89 0.23
90 0.24
91 0.24
92 0.25
93 0.29
94 0.33
95 0.29
96 0.34
97 0.32
98 0.33
99 0.33
100 0.32
101 0.28
102 0.22
103 0.22
104 0.17
105 0.12
106 0.11
107 0.11
108 0.1
109 0.11
110 0.1
111 0.1
112 0.09
113 0.09
114 0.09
115 0.1
116 0.1
117 0.1
118 0.1
119 0.12
120 0.13
121 0.18
122 0.19
123 0.17
124 0.19
125 0.19
126 0.18
127 0.17
128 0.16
129 0.1
130 0.1
131 0.09
132 0.06
133 0.07
134 0.07
135 0.07
136 0.1
137 0.1
138 0.12
139 0.18
140 0.2
141 0.23
142 0.24
143 0.31
144 0.3
145 0.33
146 0.39
147 0.36
148 0.41
149 0.45
150 0.48
151 0.44
152 0.47
153 0.48
154 0.4
155 0.39
156 0.33
157 0.26
158 0.22
159 0.21
160 0.18
161 0.14
162 0.13
163 0.11
164 0.1
165 0.1
166 0.11
167 0.1
168 0.07
169 0.07
170 0.07
171 0.08
172 0.07
173 0.06
174 0.06
175 0.06
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.07
182 0.07
183 0.06
184 0.07
185 0.1
186 0.15
187 0.16
188 0.18
189 0.18
190 0.23
191 0.25
192 0.29
193 0.34
194 0.36
195 0.37
196 0.41
197 0.46
198 0.47
199 0.53
200 0.56
201 0.58
202 0.62
203 0.68
204 0.73
205 0.75
206 0.77
207 0.8
208 0.8
209 0.78
210 0.72
211 0.72
212 0.68
213 0.61
214 0.61
215 0.55
216 0.55
217 0.53
218 0.54
219 0.51
220 0.56
221 0.63
222 0.66
223 0.74
224 0.75
225 0.79
226 0.81
227 0.82
228 0.77
229 0.67
230 0.57
231 0.46
232 0.35
233 0.24
234 0.18
235 0.11
236 0.06
237 0.05
238 0.05
239 0.05
240 0.05
241 0.04
242 0.05
243 0.05
244 0.05
245 0.06
246 0.07
247 0.09
248 0.11
249 0.15
250 0.17
251 0.18
252 0.2
253 0.21
254 0.26
255 0.26
256 0.28
257 0.29
258 0.32
259 0.35
260 0.37
261 0.39
262 0.34
263 0.39
264 0.42
265 0.47
266 0.51
267 0.53
268 0.59
269 0.66
270 0.69
271 0.7
272 0.73
273 0.72
274 0.73
275 0.78
276 0.79
277 0.74
278 0.75
279 0.74