Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8D1P2

Protein Details
Accession A0A4Y8D1P2   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MRDVKFKHSREKKRKEEEPPGSPLBasic
NLS Segment(s)
PositionSequence
8-15HSREKKRK
Subcellular Location(s) mito 17, nucl 9, cyto_mito 9
Family & Domain DBs
Amino Acid Sequences MRDVKFKHSREKKRKEEEPPGSPLPAFLAECSTTHTPSTAFLLESKGDIRISAQAYGGNRPFITYLLQIFNNPRAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.89
3 0.89
4 0.87
5 0.81
6 0.77
7 0.69
8 0.6
9 0.51
10 0.41
11 0.31
12 0.24
13 0.19
14 0.12
15 0.12
16 0.11
17 0.11
18 0.16
19 0.15
20 0.14
21 0.14
22 0.14
23 0.12
24 0.12
25 0.14
26 0.1
27 0.09
28 0.08
29 0.1
30 0.1
31 0.1
32 0.1
33 0.09
34 0.09
35 0.08
36 0.09
37 0.11
38 0.13
39 0.13
40 0.13
41 0.14
42 0.15
43 0.21
44 0.22
45 0.19
46 0.18
47 0.18
48 0.18
49 0.17
50 0.19
51 0.15
52 0.17
53 0.19
54 0.2
55 0.22
56 0.25