Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8CUX7

Protein Details
Accession A0A4Y8CUX7    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-84YERTTQHETSRKKPRRRKRRKRRSVENGTWRBasic
NLS Segment(s)
PositionSequence
64-77RKKPRRRKRRKRRS
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MLIYNDNAMYYYSPPSPSPSPTTVPTTALSPTLLYTIVYFIPAHCSIATTQQQYERTTQHETSRKKPRRRKRRKRRSVENGTWR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.23
3 0.24
4 0.27
5 0.3
6 0.31
7 0.32
8 0.33
9 0.38
10 0.34
11 0.33
12 0.3
13 0.26
14 0.23
15 0.2
16 0.17
17 0.11
18 0.11
19 0.09
20 0.08
21 0.07
22 0.06
23 0.07
24 0.06
25 0.07
26 0.07
27 0.06
28 0.1
29 0.1
30 0.11
31 0.09
32 0.1
33 0.1
34 0.17
35 0.2
36 0.17
37 0.19
38 0.22
39 0.26
40 0.27
41 0.29
42 0.25
43 0.25
44 0.29
45 0.31
46 0.35
47 0.41
48 0.44
49 0.5
50 0.6
51 0.66
52 0.71
53 0.79
54 0.82
55 0.85
56 0.92
57 0.94
58 0.94
59 0.96
60 0.96
61 0.97
62 0.97
63 0.97
64 0.96