Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8CU79

Protein Details
Accession A0A4Y8CU79    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
165-190SNDTKNGIVKRNKRNTRGKRRKGSKKBasic
NLS Segment(s)
PositionSequence
158-190RKRLRPDSNDTKNGIVKRNKRNTRGKRRKGSKK
Subcellular Location(s) nucl 15, mito_nucl 12.999, cyto_nucl 10.333, mito 9.5
Family & Domain DBs
Amino Acid Sequences MKPIKPSNISYSSSSSINASSSTSDPSSNITISPTIYTNNASNNNNSTPPTLPSISTILQQPPLPLPITSSRTYNPIIRLPTRNSASSAAVVSNTSTTTRGLVSTQRTKIIKTFVSPKGRAKITLMITITTMQEPFFDKEKNSWVMRRTTEIRKVMVRKRLRPDSNDTKNGIVKRNKRNTRGKRRKGSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.28
3 0.23
4 0.21
5 0.18
6 0.14
7 0.14
8 0.14
9 0.17
10 0.17
11 0.17
12 0.16
13 0.19
14 0.21
15 0.18
16 0.17
17 0.15
18 0.15
19 0.15
20 0.17
21 0.14
22 0.13
23 0.13
24 0.16
25 0.15
26 0.2
27 0.25
28 0.25
29 0.27
30 0.3
31 0.31
32 0.31
33 0.3
34 0.27
35 0.23
36 0.23
37 0.25
38 0.22
39 0.19
40 0.2
41 0.22
42 0.2
43 0.2
44 0.21
45 0.18
46 0.19
47 0.19
48 0.18
49 0.15
50 0.17
51 0.16
52 0.13
53 0.15
54 0.18
55 0.22
56 0.22
57 0.23
58 0.22
59 0.24
60 0.27
61 0.27
62 0.24
63 0.24
64 0.27
65 0.28
66 0.32
67 0.32
68 0.37
69 0.36
70 0.34
71 0.32
72 0.3
73 0.27
74 0.23
75 0.2
76 0.13
77 0.11
78 0.1
79 0.08
80 0.07
81 0.06
82 0.06
83 0.06
84 0.06
85 0.07
86 0.07
87 0.07
88 0.08
89 0.11
90 0.17
91 0.23
92 0.24
93 0.28
94 0.29
95 0.29
96 0.3
97 0.31
98 0.26
99 0.23
100 0.3
101 0.32
102 0.4
103 0.42
104 0.44
105 0.46
106 0.46
107 0.44
108 0.39
109 0.38
110 0.32
111 0.34
112 0.3
113 0.23
114 0.23
115 0.23
116 0.21
117 0.15
118 0.13
119 0.08
120 0.09
121 0.11
122 0.13
123 0.15
124 0.16
125 0.17
126 0.19
127 0.25
128 0.3
129 0.3
130 0.32
131 0.33
132 0.38
133 0.39
134 0.43
135 0.43
136 0.46
137 0.51
138 0.51
139 0.5
140 0.52
141 0.58
142 0.59
143 0.63
144 0.64
145 0.64
146 0.7
147 0.77
148 0.75
149 0.73
150 0.75
151 0.76
152 0.77
153 0.74
154 0.67
155 0.61
156 0.6
157 0.59
158 0.59
159 0.57
160 0.57
161 0.62
162 0.71
163 0.75
164 0.79
165 0.86
166 0.88
167 0.9
168 0.92
169 0.92
170 0.92