FuNGI

A0A4Y8CSL3

Protein Details

Accession

A0A4Y8CSL3

Localization Confidence

High

Confidence Score

16.7

NoLS Segment(s)

Position	Sequence	Protein Nature
59-89	SSQPKSTKAGRAPKPTQKLVDSRKRVKKEDD	Hydrophilic
290-312	TAPMHLARKRRFRKRISRTAIEA	Hydrophilic

NLS Segment(s)

Position	Sequence
66-85	KAGRAPKPTQKLVDSRKRVK
108-149	PAKKKVKISIKPKASAMAGVNGLPKTPVMMKAKIKGKPPKRP
297-304	RKRRFRKR

Subcellular Location(s)

nucl 14.5, mito_nucl 12.999, mito 10, cyto_nucl 9.666, cyto_mito 6.999

Family & Domain DBs

InterPro	View protein in InterPro IPR037817 TAF7 IPR006751 TAFII55_prot_cons_reg
Gene Ontology	GO:0005669 C:transcription factor TFIID complex GO:0006367 P:transcription initiation at RNA polymerase II promoter
Pfam	View protein in Pfam PF04658 TAFII55_N
CDD	cd08047 TAF7

Amino Acid Sequences

MSGSFKLKLSLKTNGGTNGSPGPSTPTTPSALTPGGSKPKIKLSSKPAGSPPLQSASSSSQPKSTKAGRAPKPTQKLVDSRKRVKKEDDSGDETISVIPRKPNLHDEPAKKKVKISIKPKASAMAGVNGLPKTPVMMKAKIKGKPPKRPLGEGYDSEASDTEKDPSIEEAFIFRMIPGDDCDYLRTCITEKKMGINPKVGGADVQMKFFHAEGRRAAVIIRGNFYAATLVDLPCIVEGMKSWDKRGWYKSADICQMLWIYQRVENEDEAKTAPLPGIIDPQTFQYPHGLTAPMHLARKRRFRKRISRTAIEAVEEAVEKLLEDDRKAISSEYKVISPEREQSSQVFSPGSYGDEGEDQYSEDEDAEGEADDGGYFSQINNADGAVSGDEMGGDLEADLAAEMEAELEAGAGFEDIAATPMSMSGVAATPMLQGDTPAPNEEDDSGDESIEDGESGDEGSEADDVDDDEKARLAQLQEAKEDIVDLEKQIEGLQAQLAAQNNPILRRRIEDKSRKLKAELEIKKSSIGEAEDD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.49
2	0.47
3	0.4
4	0.38
5	0.35
6	0.32
7	0.28
8	0.25
9	0.27
10	0.25
11	0.27
12	0.28
13	0.26
14	0.27
15	0.28
16	0.29
17	0.27
18	0.26
19	0.24
20	0.23
21	0.27
22	0.33
23	0.35
24	0.37
25	0.36
26	0.44
27	0.52
28	0.54
29	0.55
30	0.55
31	0.62
32	0.63
33	0.66
34	0.61
35	0.6
36	0.57
37	0.53
38	0.48
39	0.43
40	0.4
41	0.34
42	0.33
43	0.32
44	0.38
45	0.39
46	0.36
47	0.38
48	0.39
49	0.42
50	0.45
51	0.45
52	0.46
53	0.5
54	0.6
55	0.61
56	0.69
57	0.76
58	0.78
59	0.8
60	0.77
61	0.73
62	0.69
63	0.7
64	0.7
65	0.72
66	0.72
67	0.74
68	0.78
69	0.81
70	0.8
71	0.79
72	0.79
73	0.78
74	0.78
75	0.75
76	0.71
77	0.66
78	0.61
79	0.52
80	0.42
81	0.34
82	0.27
83	0.21
84	0.16
85	0.17
86	0.21
87	0.24
88	0.27
89	0.34
90	0.38
91	0.46
92	0.52
93	0.58
94	0.63
95	0.7
96	0.73
97	0.65
98	0.61
99	0.6
100	0.62
101	0.63
102	0.63
103	0.64
104	0.65
105	0.68
106	0.66
107	0.61
108	0.51
109	0.46
110	0.37
111	0.31
112	0.23
113	0.21
114	0.23
115	0.19
116	0.19
117	0.15
118	0.13
119	0.11
120	0.12
121	0.18
122	0.2
123	0.27
124	0.31
125	0.39
126	0.46
127	0.49
128	0.56
129	0.59
130	0.64
131	0.68
132	0.73
133	0.75
134	0.73
135	0.74
136	0.69
137	0.68
138	0.64
139	0.54
140	0.51
141	0.43
142	0.38
143	0.33
144	0.29
145	0.21
146	0.17
147	0.16
148	0.12
149	0.11
150	0.12
151	0.12
152	0.14
153	0.15
154	0.14
155	0.13
156	0.12
157	0.11
158	0.12
159	0.11
160	0.08
161	0.08
162	0.08
163	0.09
164	0.09
165	0.11
166	0.12
167	0.12
168	0.14
169	0.15
170	0.16
171	0.15
172	0.14
173	0.12
174	0.16
175	0.19
176	0.23
177	0.22
178	0.27
179	0.32
180	0.39
181	0.4
182	0.4
183	0.37
184	0.34
185	0.34
186	0.28
187	0.22
188	0.17
189	0.23
190	0.18
191	0.19
192	0.16
193	0.16
194	0.17
195	0.17
196	0.21
197	0.15
198	0.17
199	0.17
200	0.2
201	0.19
202	0.19
203	0.19
204	0.17
205	0.18
206	0.16
207	0.17
208	0.14
209	0.14
210	0.14
211	0.14
212	0.11
213	0.07
214	0.08
215	0.07
216	0.07
217	0.07
218	0.07
219	0.07
220	0.06
221	0.06
222	0.04
223	0.03
224	0.03
225	0.11
226	0.16
227	0.17
228	0.18
229	0.2
230	0.23
231	0.28
232	0.31
233	0.3
234	0.27
235	0.31
236	0.35
237	0.37
238	0.38
239	0.34
240	0.3
241	0.26
242	0.23
243	0.19
244	0.16
245	0.12
246	0.1
247	0.12
248	0.12
249	0.13
250	0.14
251	0.14
252	0.16
253	0.15
254	0.14
255	0.12
256	0.12
257	0.1
258	0.09
259	0.08
260	0.06
261	0.06
262	0.06
263	0.09
264	0.1
265	0.1
266	0.1
267	0.12
268	0.13
269	0.13
270	0.13
271	0.13
272	0.12
273	0.13
274	0.14
275	0.13
276	0.12
277	0.13
278	0.16
279	0.15
280	0.17
281	0.19
282	0.25
283	0.3
284	0.41
285	0.49
286	0.56
287	0.63
288	0.7
289	0.79
290	0.82
291	0.87
292	0.84
293	0.8
294	0.74
295	0.7
296	0.61
297	0.5
298	0.4
299	0.29
300	0.22
301	0.16
302	0.12
303	0.06
304	0.05
305	0.04
306	0.05
307	0.08
308	0.08
309	0.08
310	0.1
311	0.11
312	0.12
313	0.12
314	0.12
315	0.12
316	0.13
317	0.17
318	0.17
319	0.17
320	0.18
321	0.18
322	0.2
323	0.2
324	0.25
325	0.25
326	0.25
327	0.26
328	0.26
329	0.31
330	0.29
331	0.27
332	0.21
333	0.16
334	0.16
335	0.15
336	0.15
337	0.09
338	0.08
339	0.08
340	0.09
341	0.09
342	0.09
343	0.08
344	0.07
345	0.07
346	0.08
347	0.07
348	0.06
349	0.06
350	0.05
351	0.05
352	0.05
353	0.05
354	0.04
355	0.04
356	0.04
357	0.04
358	0.04
359	0.04
360	0.04
361	0.04
362	0.03
363	0.08
364	0.09
365	0.09
366	0.09
367	0.09
368	0.09
369	0.09
370	0.1
371	0.06
372	0.05
373	0.05
374	0.05
375	0.05
376	0.05
377	0.04
378	0.04
379	0.03
380	0.03
381	0.03
382	0.03
383	0.03
384	0.03
385	0.03
386	0.03
387	0.03
388	0.03
389	0.03
390	0.03
391	0.03
392	0.03
393	0.03
394	0.03
395	0.03
396	0.03
397	0.03
398	0.03
399	0.03
400	0.03
401	0.03
402	0.04
403	0.04
404	0.04
405	0.04
406	0.05
407	0.05
408	0.05
409	0.05
410	0.05
411	0.05
412	0.06
413	0.06
414	0.06
415	0.06
416	0.06
417	0.07
418	0.06
419	0.06
420	0.08
421	0.11
422	0.13
423	0.14
424	0.15
425	0.14
426	0.16
427	0.16
428	0.15
429	0.14
430	0.16
431	0.15
432	0.14
433	0.13
434	0.12
435	0.12
436	0.1
437	0.08
438	0.05
439	0.05
440	0.05
441	0.05
442	0.05
443	0.04
444	0.04
445	0.05
446	0.05
447	0.05
448	0.05
449	0.05
450	0.06
451	0.07
452	0.08
453	0.08
454	0.08
455	0.09
456	0.09
457	0.09
458	0.12
459	0.12
460	0.18
461	0.24
462	0.26
463	0.27
464	0.28
465	0.28
466	0.24
467	0.24
468	0.17
469	0.14
470	0.12
471	0.11
472	0.12
473	0.12
474	0.12
475	0.12
476	0.13
477	0.1
478	0.1
479	0.1
480	0.09
481	0.09
482	0.12
483	0.14
484	0.13
485	0.14
486	0.17
487	0.19
488	0.24
489	0.29
490	0.3
491	0.29
492	0.34
493	0.39
494	0.46
495	0.55
496	0.6
497	0.66
498	0.72
499	0.79
500	0.78
501	0.75
502	0.72
503	0.69
504	0.69
505	0.68
506	0.65
507	0.62
508	0.59
509	0.59
510	0.53
511	0.46
512	0.38

A0A4Y8CSL3

3D AlphaFold-predicted Structure Viewer