Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8CSL3

Protein Details
Accession A0A4Y8CSL3    Localization Confidence High Confidence Score 16.7
NoLS Segment(s)
PositionSequenceProtein Nature
59-89SSQPKSTKAGRAPKPTQKLVDSRKRVKKEDDHydrophilic
290-312TAPMHLARKRRFRKRISRTAIEAHydrophilic
NLS Segment(s)
PositionSequence
66-85KAGRAPKPTQKLVDSRKRVK
108-149PAKKKVKISIKPKASAMAGVNGLPKTPVMMKAKIKGKPPKRP
297-304RKRRFRKR
Subcellular Location(s) nucl 14.5, mito_nucl 12.999, mito 10, cyto_nucl 9.666, cyto_mito 6.999
Family & Domain DBs
InterPro View protein in InterPro  
IPR037817  TAF7  
IPR006751  TAFII55_prot_cons_reg  
Gene Ontology GO:0005669  C:transcription factor TFIID complex  
GO:0006367  P:transcription initiation at RNA polymerase II promoter  
Pfam View protein in Pfam  
PF04658  TAFII55_N  
CDD cd08047  TAF7  
Amino Acid Sequences MSGSFKLKLSLKTNGGTNGSPGPSTPTTPSALTPGGSKPKIKLSSKPAGSPPLQSASSSSQPKSTKAGRAPKPTQKLVDSRKRVKKEDDSGDETISVIPRKPNLHDEPAKKKVKISIKPKASAMAGVNGLPKTPVMMKAKIKGKPPKRPLGEGYDSEASDTEKDPSIEEAFIFRMIPGDDCDYLRTCITEKKMGINPKVGGADVQMKFFHAEGRRAAVIIRGNFYAATLVDLPCIVEGMKSWDKRGWYKSADICQMLWIYQRVENEDEAKTAPLPGIIDPQTFQYPHGLTAPMHLARKRRFRKRISRTAIEAVEEAVEKLLEDDRKAISSEYKVISPEREQSSQVFSPGSYGDEGEDQYSEDEDAEGEADDGGYFSQINNADGAVSGDEMGGDLEADLAAEMEAELEAGAGFEDIAATPMSMSGVAATPMLQGDTPAPNEEDDSGDESIEDGESGDEGSEADDVDDDEKARLAQLQEAKEDIVDLEKQIEGLQAQLAAQNNPILRRRIEDKSRKLKAELEIKKSSIGEAEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.47
3 0.4
4 0.38
5 0.35
6 0.32
7 0.28
8 0.25
9 0.27
10 0.25
11 0.27
12 0.28
13 0.26
14 0.27
15 0.28
16 0.29
17 0.27
18 0.26
19 0.24
20 0.23
21 0.27
22 0.33
23 0.35
24 0.37
25 0.36
26 0.44
27 0.52
28 0.54
29 0.55
30 0.55
31 0.62
32 0.63
33 0.66
34 0.61
35 0.6
36 0.57
37 0.53
38 0.48
39 0.43
40 0.4
41 0.34
42 0.33
43 0.32
44 0.38
45 0.39
46 0.36
47 0.38
48 0.39
49 0.42
50 0.45
51 0.45
52 0.46
53 0.5
54 0.6
55 0.61
56 0.69
57 0.76
58 0.78
59 0.8
60 0.77
61 0.73
62 0.69
63 0.7
64 0.7
65 0.72
66 0.72
67 0.74
68 0.78
69 0.81
70 0.8
71 0.79
72 0.79
73 0.78
74 0.78
75 0.75
76 0.71
77 0.66
78 0.61
79 0.52
80 0.42
81 0.34
82 0.27
83 0.21
84 0.16
85 0.17
86 0.21
87 0.24
88 0.27
89 0.34
90 0.38
91 0.46
92 0.52
93 0.58
94 0.63
95 0.7
96 0.73
97 0.65
98 0.61
99 0.6
100 0.62
101 0.63
102 0.63
103 0.64
104 0.65
105 0.68
106 0.66
107 0.61
108 0.51
109 0.46
110 0.37
111 0.31
112 0.23
113 0.21
114 0.23
115 0.19
116 0.19
117 0.15
118 0.13
119 0.11
120 0.12
121 0.18
122 0.2
123 0.27
124 0.31
125 0.39
126 0.46
127 0.49
128 0.56
129 0.59
130 0.64
131 0.68
132 0.73
133 0.75
134 0.73
135 0.74
136 0.69
137 0.68
138 0.64
139 0.54
140 0.51
141 0.43
142 0.38
143 0.33
144 0.29
145 0.21
146 0.17
147 0.16
148 0.12
149 0.11
150 0.12
151 0.12
152 0.14
153 0.15
154 0.14
155 0.13
156 0.12
157 0.11
158 0.12
159 0.11
160 0.08
161 0.08
162 0.08
163 0.09
164 0.09
165 0.11
166 0.12
167 0.12
168 0.14
169 0.15
170 0.16
171 0.15
172 0.14
173 0.12
174 0.16
175 0.19
176 0.23
177 0.22
178 0.27
179 0.32
180 0.39
181 0.4
182 0.4
183 0.37
184 0.34
185 0.34
186 0.28
187 0.22
188 0.17
189 0.23
190 0.18
191 0.19
192 0.16
193 0.16
194 0.17
195 0.17
196 0.21
197 0.15
198 0.17
199 0.17
200 0.2
201 0.19
202 0.19
203 0.19
204 0.17
205 0.18
206 0.16
207 0.17
208 0.14
209 0.14
210 0.14
211 0.14
212 0.11
213 0.07
214 0.08
215 0.07
216 0.07
217 0.07
218 0.07
219 0.07
220 0.06
221 0.06
222 0.04
223 0.03
224 0.03
225 0.11
226 0.16
227 0.17
228 0.18
229 0.2
230 0.23
231 0.28
232 0.31
233 0.3
234 0.27
235 0.31
236 0.35
237 0.37
238 0.38
239 0.34
240 0.3
241 0.26
242 0.23
243 0.19
244 0.16
245 0.12
246 0.1
247 0.12
248 0.12
249 0.13
250 0.14
251 0.14
252 0.16
253 0.15
254 0.14
255 0.12
256 0.12
257 0.1
258 0.09
259 0.08
260 0.06
261 0.06
262 0.06
263 0.09
264 0.1
265 0.1
266 0.1
267 0.12
268 0.13
269 0.13
270 0.13
271 0.13
272 0.12
273 0.13
274 0.14
275 0.13
276 0.12
277 0.13
278 0.16
279 0.15
280 0.17
281 0.19
282 0.25
283 0.3
284 0.41
285 0.49
286 0.56
287 0.63
288 0.7
289 0.79
290 0.82
291 0.87
292 0.84
293 0.8
294 0.74
295 0.7
296 0.61
297 0.5
298 0.4
299 0.29
300 0.22
301 0.16
302 0.12
303 0.06
304 0.05
305 0.04
306 0.05
307 0.08
308 0.08
309 0.08
310 0.1
311 0.11
312 0.12
313 0.12
314 0.12
315 0.12
316 0.13
317 0.17
318 0.17
319 0.17
320 0.18
321 0.18
322 0.2
323 0.2
324 0.25
325 0.25
326 0.25
327 0.26
328 0.26
329 0.31
330 0.29
331 0.27
332 0.21
333 0.16
334 0.16
335 0.15
336 0.15
337 0.09
338 0.08
339 0.08
340 0.09
341 0.09
342 0.09
343 0.08
344 0.07
345 0.07
346 0.08
347 0.07
348 0.06
349 0.06
350 0.05
351 0.05
352 0.05
353 0.05
354 0.04
355 0.04
356 0.04
357 0.04
358 0.04
359 0.04
360 0.04
361 0.04
362 0.03
363 0.08
364 0.09
365 0.09
366 0.09
367 0.09
368 0.09
369 0.09
370 0.1
371 0.06
372 0.05
373 0.05
374 0.05
375 0.05
376 0.05
377 0.04
378 0.04
379 0.03
380 0.03
381 0.03
382 0.03
383 0.03
384 0.03
385 0.03
386 0.03
387 0.03
388 0.03
389 0.03
390 0.03
391 0.03
392 0.03
393 0.03
394 0.03
395 0.03
396 0.03
397 0.03
398 0.03
399 0.03
400 0.03
401 0.03
402 0.04
403 0.04
404 0.04
405 0.04
406 0.05
407 0.05
408 0.05
409 0.05
410 0.05
411 0.05
412 0.06
413 0.06
414 0.06
415 0.06
416 0.06
417 0.07
418 0.06
419 0.06
420 0.08
421 0.11
422 0.13
423 0.14
424 0.15
425 0.14
426 0.16
427 0.16
428 0.15
429 0.14
430 0.16
431 0.15
432 0.14
433 0.13
434 0.12
435 0.12
436 0.1
437 0.08
438 0.05
439 0.05
440 0.05
441 0.05
442 0.05
443 0.04
444 0.04
445 0.05
446 0.05
447 0.05
448 0.05
449 0.05
450 0.06
451 0.07
452 0.08
453 0.08
454 0.08
455 0.09
456 0.09
457 0.09
458 0.12
459 0.12
460 0.18
461 0.24
462 0.26
463 0.27
464 0.28
465 0.28
466 0.24
467 0.24
468 0.17
469 0.14
470 0.12
471 0.11
472 0.12
473 0.12
474 0.12
475 0.12
476 0.13
477 0.1
478 0.1
479 0.1
480 0.09
481 0.09
482 0.12
483 0.14
484 0.13
485 0.14
486 0.17
487 0.19
488 0.24
489 0.29
490 0.3
491 0.29
492 0.34
493 0.39
494 0.46
495 0.55
496 0.6
497 0.66
498 0.72
499 0.79
500 0.78
501 0.75
502 0.72
503 0.69
504 0.69
505 0.68
506 0.65
507 0.62
508 0.59
509 0.59
510 0.53
511 0.46
512 0.38