Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8DBW6

Protein Details
Accession A0A4Y8DBW6   
Localization Confidence High
Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
65-118QAKNKVAKKKSDRRKDYKKKAEWKKAEKRKSDKRKKKNKKTSMKKNNRTFNVPQBasic
121-140SKAHIEKKTRLNKVKKVTTLHydrophilic
NLS Segment(s)
PositionSequence
52-114KNKKQRKATLAKIQAKNKVAKKKSDRRKDYKKKAEWKKAEKRKSDKRKKKNKKTSMKKNNRTF
119-131HGSKAHIEKKTRL
Subcellular Location(s) nucl 12.5, mito 12, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MSKDNIQPGPAKSLGLGKAFMALSRSTSLTVASIKQKFKPDTATSDLPNEAKNKKQRKATLAKIQAKNKVAKKKSDRRKDYKKKAEWKKAEKRKSDKRKKKNKKTSMKKNNRTFNVPQHGSKAHIEKKTRLNKVKKVTTLSKDSYLNVKNFCKQKFSTFHCTKIF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.27
3 0.25
4 0.18
5 0.22
6 0.21
7 0.21
8 0.17
9 0.14
10 0.14
11 0.16
12 0.16
13 0.14
14 0.14
15 0.14
16 0.13
17 0.15
18 0.16
19 0.22
20 0.27
21 0.29
22 0.34
23 0.42
24 0.42
25 0.43
26 0.47
27 0.43
28 0.43
29 0.47
30 0.46
31 0.39
32 0.39
33 0.39
34 0.32
35 0.31
36 0.29
37 0.25
38 0.29
39 0.37
40 0.43
41 0.47
42 0.55
43 0.59
44 0.63
45 0.69
46 0.71
47 0.72
48 0.73
49 0.76
50 0.75
51 0.74
52 0.71
53 0.66
54 0.64
55 0.61
56 0.61
57 0.55
58 0.57
59 0.62
60 0.66
61 0.72
62 0.76
63 0.78
64 0.79
65 0.87
66 0.88
67 0.89
68 0.9
69 0.88
70 0.88
71 0.89
72 0.89
73 0.87
74 0.87
75 0.86
76 0.86
77 0.86
78 0.84
79 0.84
80 0.84
81 0.86
82 0.87
83 0.87
84 0.88
85 0.91
86 0.94
87 0.95
88 0.96
89 0.95
90 0.95
91 0.95
92 0.96
93 0.96
94 0.95
95 0.94
96 0.92
97 0.91
98 0.84
99 0.8
100 0.74
101 0.72
102 0.71
103 0.64
104 0.56
105 0.51
106 0.48
107 0.44
108 0.43
109 0.41
110 0.38
111 0.42
112 0.45
113 0.46
114 0.55
115 0.61
116 0.67
117 0.69
118 0.71
119 0.73
120 0.79
121 0.82
122 0.78
123 0.76
124 0.74
125 0.71
126 0.7
127 0.65
128 0.6
129 0.53
130 0.49
131 0.49
132 0.46
133 0.44
134 0.42
135 0.43
136 0.45
137 0.51
138 0.52
139 0.5
140 0.47
141 0.52
142 0.55
143 0.58
144 0.62
145 0.6