Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q756Z2

Protein Details
Accession Q756Z2    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
21-41CLPRRWQLYKDQRRLHRPGGRBasic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, mito 6, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013900  RNR_inhibitor  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:1990846  F:ribonucleoside-diphosphate reductase inhibitor activity  
GO:1905117  P:regulation of ribonucleoside-diphosphate reductase activity  
KEGG ago:AGOS_AER122C  -  
Pfam View protein in Pfam  
PF08591  RNR_inhib  
Amino Acid Sequences MCLYVNKEHPYTQASGPWPACLPRRWQLYKDQRRLHRPGGRRPMSTSDSHLGSPRKRQLQRAAPAAPQHSEYQQQLSTLGMRIRQAVDNGYRAPQDPVRAAVPHAVPAAACVQDNTLYTVPDYKRVPLAADRAPPMLVNQRTVSSTSSLQAWESQLDERLSLIDSSIMHNKLGAGEFMLGGTKRAFDQLETDNW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.36
3 0.35
4 0.35
5 0.32
6 0.33
7 0.35
8 0.33
9 0.37
10 0.37
11 0.46
12 0.49
13 0.5
14 0.57
15 0.63
16 0.71
17 0.74
18 0.75
19 0.74
20 0.78
21 0.82
22 0.81
23 0.79
24 0.76
25 0.77
26 0.79
27 0.76
28 0.69
29 0.66
30 0.63
31 0.58
32 0.52
33 0.47
34 0.39
35 0.35
36 0.34
37 0.35
38 0.34
39 0.33
40 0.4
41 0.42
42 0.48
43 0.5
44 0.56
45 0.61
46 0.64
47 0.67
48 0.66
49 0.61
50 0.54
51 0.54
52 0.49
53 0.4
54 0.32
55 0.27
56 0.21
57 0.22
58 0.2
59 0.19
60 0.18
61 0.17
62 0.15
63 0.14
64 0.14
65 0.13
66 0.13
67 0.11
68 0.11
69 0.12
70 0.13
71 0.13
72 0.13
73 0.14
74 0.15
75 0.15
76 0.15
77 0.15
78 0.14
79 0.14
80 0.15
81 0.14
82 0.14
83 0.12
84 0.14
85 0.14
86 0.14
87 0.13
88 0.14
89 0.13
90 0.13
91 0.12
92 0.1
93 0.09
94 0.09
95 0.1
96 0.08
97 0.07
98 0.06
99 0.07
100 0.08
101 0.09
102 0.11
103 0.1
104 0.1
105 0.1
106 0.16
107 0.16
108 0.2
109 0.2
110 0.18
111 0.2
112 0.2
113 0.22
114 0.19
115 0.24
116 0.22
117 0.25
118 0.25
119 0.24
120 0.24
121 0.22
122 0.21
123 0.24
124 0.22
125 0.21
126 0.21
127 0.21
128 0.22
129 0.24
130 0.23
131 0.18
132 0.18
133 0.16
134 0.16
135 0.15
136 0.14
137 0.15
138 0.14
139 0.13
140 0.13
141 0.13
142 0.16
143 0.16
144 0.15
145 0.13
146 0.13
147 0.13
148 0.12
149 0.11
150 0.09
151 0.09
152 0.12
153 0.19
154 0.19
155 0.17
156 0.18
157 0.18
158 0.18
159 0.19
160 0.15
161 0.11
162 0.1
163 0.1
164 0.1
165 0.13
166 0.11
167 0.11
168 0.11
169 0.11
170 0.11
171 0.14
172 0.15
173 0.13
174 0.18