Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8CVH4

Protein Details
Accession A0A4Y8CVH4    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
219-241VTYTPRMSPAPKGKRRKVDHHVEHydrophilic
NLS Segment(s)
PositionSequence
230-235KGKRRK
Subcellular Location(s) mito 13, nucl 11.5, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MESPIKASAPAAVSAPILPPPKRSMSTTKPKLPQLKTPMSSTFPSELSALSNSARSPLPGYADFIIKQEDSIKTPITPPLAYTDFLKTMNSPVVTEIKCSRPTPTSAPSSESLTSSEGSDCSCNCDAHKSPATSVPPTPFNYPTSAPSSAMLGRLRIPASPASSYAESPLSARSPFSARSARSPYDWDLRGKARYFDIKPQKQTRSSVRQVREVVTRTVTYTPRMSPAPKGKRRKVDHHVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.16
3 0.17
4 0.21
5 0.21
6 0.24
7 0.28
8 0.34
9 0.36
10 0.4
11 0.43
12 0.48
13 0.58
14 0.64
15 0.68
16 0.68
17 0.74
18 0.79
19 0.74
20 0.73
21 0.72
22 0.72
23 0.66
24 0.64
25 0.59
26 0.54
27 0.51
28 0.45
29 0.38
30 0.29
31 0.27
32 0.23
33 0.19
34 0.17
35 0.17
36 0.14
37 0.12
38 0.13
39 0.11
40 0.13
41 0.13
42 0.12
43 0.13
44 0.13
45 0.17
46 0.16
47 0.19
48 0.18
49 0.2
50 0.2
51 0.18
52 0.19
53 0.15
54 0.14
55 0.15
56 0.16
57 0.16
58 0.18
59 0.18
60 0.17
61 0.18
62 0.21
63 0.2
64 0.18
65 0.16
66 0.19
67 0.2
68 0.2
69 0.2
70 0.2
71 0.18
72 0.19
73 0.19
74 0.14
75 0.14
76 0.16
77 0.15
78 0.12
79 0.13
80 0.18
81 0.18
82 0.2
83 0.21
84 0.22
85 0.25
86 0.26
87 0.27
88 0.23
89 0.26
90 0.28
91 0.3
92 0.3
93 0.28
94 0.3
95 0.29
96 0.3
97 0.27
98 0.23
99 0.19
100 0.16
101 0.15
102 0.12
103 0.12
104 0.08
105 0.08
106 0.09
107 0.07
108 0.11
109 0.12
110 0.12
111 0.12
112 0.17
113 0.18
114 0.23
115 0.28
116 0.24
117 0.24
118 0.29
119 0.31
120 0.28
121 0.28
122 0.25
123 0.24
124 0.25
125 0.28
126 0.24
127 0.23
128 0.24
129 0.23
130 0.24
131 0.25
132 0.24
133 0.21
134 0.19
135 0.2
136 0.18
137 0.2
138 0.17
139 0.13
140 0.14
141 0.16
142 0.16
143 0.14
144 0.15
145 0.14
146 0.16
147 0.16
148 0.16
149 0.17
150 0.18
151 0.18
152 0.18
153 0.16
154 0.14
155 0.13
156 0.14
157 0.12
158 0.12
159 0.12
160 0.12
161 0.14
162 0.16
163 0.2
164 0.24
165 0.24
166 0.31
167 0.37
168 0.37
169 0.36
170 0.39
171 0.38
172 0.4
173 0.41
174 0.36
175 0.35
176 0.38
177 0.42
178 0.39
179 0.37
180 0.34
181 0.4
182 0.4
183 0.45
184 0.52
185 0.55
186 0.63
187 0.69
188 0.72
189 0.69
190 0.73
191 0.73
192 0.72
193 0.73
194 0.73
195 0.68
196 0.69
197 0.66
198 0.63
199 0.61
200 0.54
201 0.48
202 0.43
203 0.39
204 0.33
205 0.36
206 0.34
207 0.31
208 0.31
209 0.3
210 0.3
211 0.34
212 0.34
213 0.38
214 0.47
215 0.54
216 0.6
217 0.69
218 0.74
219 0.8
220 0.86
221 0.87