Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8CR88

Protein Details
Accession A0A4Y8CR88    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
232-263DLWRLRRPLDPPKPKSKKGKKGPRPRQDGDGVBasic
NLS Segment(s)
PositionSequence
237-257RRPLDPPKPKSKKGKKGPRPR
Subcellular Location(s) cyto 10.5, cyto_nucl 7.5, extr 7, pero 5, nucl 3.5
Family & Domain DBs
Amino Acid Sequences MSYNLPGIDAVGLRPYINLVVEPAPAAPVLAPGLPAGPRLGLSAGPRPGVPAAPVPVLKLPAGPPGSNAPAAIAAPVEERPFPSWPGNSKPIPADQQPLTIWSRTSNKDALKNYVQGEYDLLPGGVDVVGSRAWLLNSHPGAQEKGTPWLLVSLLGRNGWTNNRVIVDAFTRMSTQRVHKFAEAAVGSDQYGKLWKYADTHIRQTISKKGFNDLFINKGDAGIFGDDVEGEDLWRLRRPLDPPKPKSKKGKKGPRPRQDGDGVGPPGDPDN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.11
4 0.11
5 0.11
6 0.11
7 0.12
8 0.12
9 0.13
10 0.11
11 0.11
12 0.1
13 0.1
14 0.07
15 0.07
16 0.08
17 0.07
18 0.08
19 0.07
20 0.09
21 0.09
22 0.1
23 0.09
24 0.08
25 0.09
26 0.09
27 0.1
28 0.11
29 0.14
30 0.2
31 0.21
32 0.22
33 0.21
34 0.22
35 0.22
36 0.2
37 0.19
38 0.16
39 0.16
40 0.18
41 0.19
42 0.18
43 0.19
44 0.2
45 0.18
46 0.16
47 0.15
48 0.19
49 0.21
50 0.19
51 0.2
52 0.22
53 0.25
54 0.23
55 0.22
56 0.16
57 0.14
58 0.14
59 0.12
60 0.08
61 0.06
62 0.07
63 0.08
64 0.08
65 0.08
66 0.1
67 0.12
68 0.14
69 0.17
70 0.19
71 0.21
72 0.25
73 0.3
74 0.35
75 0.33
76 0.33
77 0.32
78 0.33
79 0.34
80 0.31
81 0.3
82 0.25
83 0.27
84 0.25
85 0.26
86 0.24
87 0.2
88 0.19
89 0.18
90 0.22
91 0.22
92 0.25
93 0.27
94 0.29
95 0.35
96 0.37
97 0.38
98 0.36
99 0.37
100 0.35
101 0.33
102 0.29
103 0.23
104 0.22
105 0.17
106 0.15
107 0.11
108 0.1
109 0.06
110 0.06
111 0.06
112 0.04
113 0.03
114 0.02
115 0.03
116 0.03
117 0.03
118 0.04
119 0.04
120 0.04
121 0.05
122 0.06
123 0.11
124 0.11
125 0.13
126 0.14
127 0.15
128 0.15
129 0.15
130 0.17
131 0.12
132 0.16
133 0.15
134 0.14
135 0.13
136 0.13
137 0.12
138 0.11
139 0.1
140 0.08
141 0.09
142 0.09
143 0.09
144 0.09
145 0.1
146 0.11
147 0.12
148 0.11
149 0.12
150 0.13
151 0.13
152 0.13
153 0.12
154 0.12
155 0.12
156 0.12
157 0.11
158 0.11
159 0.11
160 0.13
161 0.15
162 0.2
163 0.25
164 0.28
165 0.3
166 0.3
167 0.31
168 0.29
169 0.32
170 0.25
171 0.19
172 0.17
173 0.15
174 0.14
175 0.14
176 0.14
177 0.08
178 0.11
179 0.1
180 0.1
181 0.11
182 0.12
183 0.15
184 0.21
185 0.3
186 0.32
187 0.37
188 0.4
189 0.41
190 0.42
191 0.42
192 0.45
193 0.42
194 0.42
195 0.37
196 0.4
197 0.4
198 0.41
199 0.44
200 0.37
201 0.35
202 0.31
203 0.32
204 0.26
205 0.23
206 0.21
207 0.14
208 0.14
209 0.11
210 0.1
211 0.07
212 0.08
213 0.07
214 0.07
215 0.08
216 0.06
217 0.06
218 0.07
219 0.09
220 0.11
221 0.15
222 0.15
223 0.15
224 0.21
225 0.27
226 0.37
227 0.47
228 0.56
229 0.6
230 0.71
231 0.79
232 0.83
233 0.87
234 0.87
235 0.87
236 0.87
237 0.91
238 0.9
239 0.93
240 0.95
241 0.94
242 0.93
243 0.86
244 0.83
245 0.78
246 0.71
247 0.65
248 0.62
249 0.53
250 0.44
251 0.39