Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8CMY7

Protein Details
Accession A0A4Y8CMY7    Localization Confidence Low Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
92-120ADQATGKSKRKNHRGGNKTKESKTKRENTHydrophilic
NLS Segment(s)
PositionSequence
82-117RKLGKRFKRGADQATGKSKRKNHRGGNKTKESKTKR
Subcellular Location(s) plas 8, mito 6, golg 4, mito_nucl 4, nucl 2, extr 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MSSPGIKPHTTAAVQEAGLHLVGCSAYVAMIFKSLSCCLKHTRQYIVFVGPIMIWLFILSLRQTYNGFQEVIENWNSDEAMRKLGKRFKRGADQATGKSKRKNHRGGNKTKESKTKRENTGSSISGEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.23
3 0.2
4 0.15
5 0.14
6 0.13
7 0.09
8 0.06
9 0.06
10 0.06
11 0.05
12 0.04
13 0.04
14 0.04
15 0.05
16 0.04
17 0.06
18 0.06
19 0.06
20 0.09
21 0.11
22 0.14
23 0.14
24 0.17
25 0.22
26 0.29
27 0.36
28 0.37
29 0.43
30 0.43
31 0.46
32 0.45
33 0.41
34 0.34
35 0.27
36 0.23
37 0.15
38 0.13
39 0.09
40 0.07
41 0.05
42 0.04
43 0.04
44 0.04
45 0.05
46 0.04
47 0.05
48 0.05
49 0.06
50 0.07
51 0.08
52 0.1
53 0.11
54 0.11
55 0.1
56 0.11
57 0.11
58 0.12
59 0.12
60 0.1
61 0.09
62 0.09
63 0.09
64 0.08
65 0.12
66 0.1
67 0.15
68 0.16
69 0.18
70 0.23
71 0.31
72 0.38
73 0.41
74 0.46
75 0.47
76 0.55
77 0.59
78 0.58
79 0.59
80 0.58
81 0.57
82 0.62
83 0.63
84 0.58
85 0.59
86 0.62
87 0.64
88 0.68
89 0.73
90 0.73
91 0.76
92 0.82
93 0.86
94 0.88
95 0.89
96 0.88
97 0.84
98 0.84
99 0.81
100 0.81
101 0.8
102 0.8
103 0.78
104 0.79
105 0.76
106 0.71
107 0.71
108 0.63