Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8CX17

Protein Details
Accession A0A4Y8CX17   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
10-39SNDSKDEGPKPKRKRLIKKRPSTHTPTSPNHydrophilic
NLS Segment(s)
PositionSequence
17-30GPKPKRKRLIKKRP
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MNPKKSIIGSNDSKDEGPKPKRKRLIKKRPSTHTPTSPNDLAANQTTSPSTGAPSNREDLDLKSKARAKNLQELGDHEARPSTTLDIVSTPSTPSQRHYPPPQGKRENDISHPPNHIADKTLAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.41
4 0.44
5 0.49
6 0.55
7 0.63
8 0.72
9 0.8
10 0.86
11 0.87
12 0.89
13 0.89
14 0.92
15 0.91
16 0.91
17 0.89
18 0.86
19 0.83
20 0.8
21 0.77
22 0.7
23 0.68
24 0.59
25 0.52
26 0.44
27 0.36
28 0.29
29 0.23
30 0.21
31 0.14
32 0.14
33 0.12
34 0.12
35 0.12
36 0.1
37 0.09
38 0.1
39 0.12
40 0.14
41 0.16
42 0.18
43 0.17
44 0.18
45 0.18
46 0.17
47 0.23
48 0.23
49 0.21
50 0.23
51 0.29
52 0.29
53 0.33
54 0.37
55 0.34
56 0.4
57 0.44
58 0.42
59 0.38
60 0.39
61 0.39
62 0.36
63 0.33
64 0.23
65 0.2
66 0.17
67 0.17
68 0.16
69 0.11
70 0.09
71 0.09
72 0.1
73 0.1
74 0.12
75 0.12
76 0.11
77 0.11
78 0.13
79 0.16
80 0.16
81 0.19
82 0.25
83 0.3
84 0.38
85 0.45
86 0.53
87 0.6
88 0.68
89 0.75
90 0.76
91 0.73
92 0.72
93 0.74
94 0.68
95 0.63
96 0.65
97 0.58
98 0.54
99 0.55
100 0.5
101 0.45
102 0.44
103 0.39
104 0.32