Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8CX94

Protein Details
Accession A0A4Y8CX94    Localization Confidence High Confidence Score 17.8
NoLS Segment(s)
PositionSequenceProtein Nature
38-68KNVATGSPTKPRKRAPPKKKAKSAAEPMTGGHydrophilic
137-162GDIKEEEPKKKRLPRKKKVVDVSTDVBasic
487-519RAGKKTVVKKVAKKVNKGSKKRKRNFEDSDEEABasic
NLS Segment(s)
PositionSequence
46-60TKPRKRAPPKKKAKS
144-154PKKKRLPRKKK
481-510KKQPGFRAGKKTVVKKVAKKVNKGSKKRKR
Subcellular Location(s) cyto 13.5, cyto_mito 11.5, mito 8.5, nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011257  DNA_glycosylase  
IPR003265  HhH-GPD_domain  
IPR023170  HhH_base_excis_C  
Gene Ontology GO:0000702  F:oxidized base lesion DNA N-glycosylase activity  
GO:0006285  P:base-excision repair, AP site formation  
Pfam View protein in Pfam  
PF00730  HhH-GPD  
CDD cd00056  ENDO3c  
Amino Acid Sequences MPTRAATKAAEAAAALSYAAATLSSPPATPANGKQILKNVATGSPTKPRKRAPPKKKAKSAAEPMTGGWDVLPHGMGHKGDLLDADFGNTGTEVTPTTPKRATRARATKATVKVSIKDEDEEKPLDFGDSGIPDLLGDIKEEEPKKKRLPRKKKVVDVSTDVDGSQAKPVKTKKKNYGIVFGETPFPDHISPTAQEAETVNSLLTALHGEVKPPGTVPAPSETVTGCGEVPDVLDATMRTLLSAATTAGNANKSMAGLKAEYGLRTSGKGAGSVSWEAVFASSKEDVEEAIRSGGLAKVKAGYIKAILQVVFDKNTDLLETLLKEVETDVPVPFVGKVLETKEQKEAEIKSLRENMLSLDYVHTLDKPAAMRVLMDLPGIGVKTAACVALFCLGRPSFAVDTHVWRHCMWLGWVPEKASRDQTFSHCEVRIPDHLKYSLHQLFLRHGKTCGRCRAATSEGSADWESTVCPIEHLVNRTGDKKQPGFRAGKKTVVKKVAKKVNKGSKKRKRNFEDSDEEAEVEADKENDMEFEENKGDDETDIEVEAGTESRVSVQSDSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.06
4 0.06
5 0.05
6 0.05
7 0.04
8 0.04
9 0.06
10 0.09
11 0.1
12 0.1
13 0.13
14 0.15
15 0.17
16 0.21
17 0.24
18 0.31
19 0.38
20 0.39
21 0.4
22 0.46
23 0.5
24 0.46
25 0.45
26 0.37
27 0.32
28 0.34
29 0.34
30 0.31
31 0.35
32 0.44
33 0.49
34 0.54
35 0.59
36 0.67
37 0.76
38 0.82
39 0.84
40 0.85
41 0.89
42 0.92
43 0.95
44 0.94
45 0.92
46 0.91
47 0.9
48 0.87
49 0.81
50 0.71
51 0.6
52 0.56
53 0.46
54 0.35
55 0.25
56 0.17
57 0.12
58 0.12
59 0.12
60 0.07
61 0.08
62 0.12
63 0.12
64 0.12
65 0.14
66 0.14
67 0.13
68 0.14
69 0.14
70 0.13
71 0.13
72 0.13
73 0.1
74 0.1
75 0.1
76 0.09
77 0.08
78 0.07
79 0.07
80 0.07
81 0.09
82 0.17
83 0.18
84 0.23
85 0.28
86 0.29
87 0.36
88 0.44
89 0.48
90 0.51
91 0.6
92 0.62
93 0.66
94 0.69
95 0.7
96 0.68
97 0.67
98 0.63
99 0.55
100 0.52
101 0.48
102 0.47
103 0.4
104 0.36
105 0.34
106 0.29
107 0.3
108 0.28
109 0.24
110 0.21
111 0.19
112 0.18
113 0.15
114 0.12
115 0.11
116 0.1
117 0.1
118 0.1
119 0.09
120 0.08
121 0.09
122 0.1
123 0.07
124 0.06
125 0.08
126 0.09
127 0.15
128 0.18
129 0.26
130 0.3
131 0.37
132 0.46
133 0.54
134 0.63
135 0.68
136 0.77
137 0.8
138 0.86
139 0.89
140 0.89
141 0.9
142 0.86
143 0.81
144 0.75
145 0.67
146 0.57
147 0.48
148 0.38
149 0.29
150 0.22
151 0.17
152 0.17
153 0.18
154 0.16
155 0.22
156 0.3
157 0.4
158 0.48
159 0.57
160 0.62
161 0.68
162 0.76
163 0.74
164 0.76
165 0.68
166 0.63
167 0.55
168 0.46
169 0.39
170 0.3
171 0.28
172 0.19
173 0.18
174 0.14
175 0.13
176 0.13
177 0.12
178 0.13
179 0.14
180 0.15
181 0.13
182 0.14
183 0.14
184 0.15
185 0.13
186 0.13
187 0.1
188 0.07
189 0.08
190 0.07
191 0.06
192 0.05
193 0.05
194 0.08
195 0.08
196 0.09
197 0.1
198 0.11
199 0.11
200 0.11
201 0.12
202 0.1
203 0.1
204 0.12
205 0.13
206 0.14
207 0.15
208 0.15
209 0.14
210 0.15
211 0.14
212 0.13
213 0.1
214 0.08
215 0.08
216 0.07
217 0.07
218 0.05
219 0.05
220 0.04
221 0.05
222 0.04
223 0.05
224 0.07
225 0.06
226 0.06
227 0.06
228 0.06
229 0.06
230 0.06
231 0.06
232 0.04
233 0.05
234 0.05
235 0.07
236 0.07
237 0.07
238 0.07
239 0.07
240 0.07
241 0.07
242 0.07
243 0.07
244 0.07
245 0.07
246 0.09
247 0.1
248 0.1
249 0.1
250 0.11
251 0.1
252 0.1
253 0.11
254 0.11
255 0.11
256 0.11
257 0.11
258 0.1
259 0.12
260 0.12
261 0.11
262 0.08
263 0.08
264 0.07
265 0.07
266 0.07
267 0.05
268 0.07
269 0.07
270 0.07
271 0.07
272 0.07
273 0.07
274 0.08
275 0.08
276 0.06
277 0.06
278 0.06
279 0.05
280 0.06
281 0.07
282 0.08
283 0.07
284 0.07
285 0.08
286 0.08
287 0.09
288 0.09
289 0.08
290 0.08
291 0.09
292 0.11
293 0.11
294 0.1
295 0.1
296 0.12
297 0.12
298 0.12
299 0.11
300 0.1
301 0.09
302 0.09
303 0.09
304 0.07
305 0.07
306 0.07
307 0.07
308 0.07
309 0.08
310 0.07
311 0.07
312 0.07
313 0.08
314 0.08
315 0.08
316 0.08
317 0.08
318 0.08
319 0.08
320 0.08
321 0.07
322 0.06
323 0.05
324 0.07
325 0.1
326 0.17
327 0.18
328 0.2
329 0.25
330 0.25
331 0.25
332 0.28
333 0.27
334 0.27
335 0.31
336 0.3
337 0.29
338 0.34
339 0.33
340 0.29
341 0.28
342 0.22
343 0.18
344 0.18
345 0.14
346 0.11
347 0.11
348 0.12
349 0.12
350 0.11
351 0.09
352 0.09
353 0.11
354 0.1
355 0.1
356 0.1
357 0.1
358 0.1
359 0.1
360 0.12
361 0.1
362 0.09
363 0.08
364 0.07
365 0.08
366 0.08
367 0.06
368 0.05
369 0.04
370 0.05
371 0.05
372 0.06
373 0.05
374 0.05
375 0.06
376 0.11
377 0.11
378 0.1
379 0.16
380 0.15
381 0.16
382 0.16
383 0.2
384 0.16
385 0.16
386 0.2
387 0.16
388 0.22
389 0.27
390 0.29
391 0.27
392 0.26
393 0.28
394 0.25
395 0.25
396 0.22
397 0.23
398 0.24
399 0.25
400 0.27
401 0.26
402 0.29
403 0.29
404 0.3
405 0.31
406 0.29
407 0.29
408 0.31
409 0.34
410 0.36
411 0.38
412 0.4
413 0.33
414 0.33
415 0.32
416 0.33
417 0.37
418 0.35
419 0.34
420 0.33
421 0.35
422 0.34
423 0.33
424 0.37
425 0.33
426 0.32
427 0.32
428 0.28
429 0.33
430 0.41
431 0.43
432 0.35
433 0.34
434 0.38
435 0.44
436 0.52
437 0.54
438 0.52
439 0.5
440 0.52
441 0.56
442 0.52
443 0.46
444 0.41
445 0.35
446 0.29
447 0.32
448 0.29
449 0.22
450 0.18
451 0.16
452 0.13
453 0.11
454 0.13
455 0.09
456 0.09
457 0.1
458 0.15
459 0.19
460 0.23
461 0.25
462 0.28
463 0.31
464 0.34
465 0.37
466 0.38
467 0.42
468 0.45
469 0.49
470 0.51
471 0.57
472 0.62
473 0.65
474 0.7
475 0.66
476 0.69
477 0.69
478 0.7
479 0.71
480 0.72
481 0.73
482 0.71
483 0.77
484 0.79
485 0.79
486 0.8
487 0.81
488 0.82
489 0.84
490 0.87
491 0.88
492 0.88
493 0.92
494 0.92
495 0.93
496 0.91
497 0.91
498 0.89
499 0.87
500 0.84
501 0.79
502 0.75
503 0.66
504 0.57
505 0.46
506 0.37
507 0.28
508 0.21
509 0.16
510 0.09
511 0.08
512 0.08
513 0.08
514 0.08
515 0.1
516 0.12
517 0.11
518 0.14
519 0.16
520 0.16
521 0.17
522 0.18
523 0.16
524 0.14
525 0.15
526 0.13
527 0.12
528 0.13
529 0.11
530 0.1
531 0.1
532 0.1
533 0.09
534 0.07
535 0.06
536 0.06
537 0.09
538 0.11
539 0.13