Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8CVH8

Protein Details
Accession A0A4Y8CVH8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
18-40IRGKSRKAEKGGRKDEKNKKNEABasic
NLS Segment(s)
PositionSequence
19-37RGKSRKAEKGGRKDEKNKK
Subcellular Location(s) mito 13, nucl 12.5, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences MGFDFNLMLQRGRNVSIIRGKSRKAEKGGRKDEKNKKNEAYLASCCDVVATTPGTYTNLQSAQALNTASLLLRELSREGFMKKQTSYSKDPAHFIYSSPLTTPSSVKAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.25
3 0.32
4 0.37
5 0.42
6 0.45
7 0.45
8 0.49
9 0.56
10 0.57
11 0.56
12 0.61
13 0.62
14 0.69
15 0.77
16 0.78
17 0.79
18 0.82
19 0.85
20 0.84
21 0.81
22 0.78
23 0.69
24 0.65
25 0.61
26 0.54
27 0.49
28 0.42
29 0.39
30 0.32
31 0.29
32 0.25
33 0.2
34 0.16
35 0.11
36 0.09
37 0.07
38 0.06
39 0.06
40 0.06
41 0.08
42 0.09
43 0.09
44 0.1
45 0.1
46 0.1
47 0.1
48 0.11
49 0.09
50 0.1
51 0.1
52 0.08
53 0.07
54 0.07
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.06
61 0.07
62 0.08
63 0.1
64 0.11
65 0.13
66 0.17
67 0.21
68 0.24
69 0.24
70 0.31
71 0.36
72 0.4
73 0.45
74 0.49
75 0.53
76 0.52
77 0.54
78 0.5
79 0.47
80 0.41
81 0.35
82 0.35
83 0.28
84 0.26
85 0.24
86 0.24
87 0.22
88 0.23
89 0.24