Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8D3C0

Protein Details
Accession A0A4Y8D3C0   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
136-157DKVIKKKATVTKGKRGNRSIKDBasic
NLS Segment(s)
PositionSequence
120-153KPKRNNKASVKDKVSQDKVIKKKATVTKGKRGNR
Subcellular Location(s) cyto 15, nucl 11
Family & Domain DBs
Amino Acid Sequences MSEESHRPKMTQAEIDLLWAIFENVPKEQINSCVVGTLEAVAAQLGIRKTAAEKRWSRLSIRVRKGKEVADKGAVARVTEETETKASSEDDEAVTKNVGGKDLTQDAADEKAITTAIGVKPKRNNKASVKDKVSQDKVIKKKATVTKGKRGNRSIKDEADVKSNVKEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.35
3 0.32
4 0.24
5 0.19
6 0.13
7 0.12
8 0.09
9 0.1
10 0.11
11 0.11
12 0.14
13 0.15
14 0.17
15 0.17
16 0.19
17 0.2
18 0.19
19 0.18
20 0.17
21 0.17
22 0.15
23 0.14
24 0.11
25 0.08
26 0.06
27 0.06
28 0.05
29 0.05
30 0.04
31 0.07
32 0.06
33 0.07
34 0.07
35 0.07
36 0.1
37 0.17
38 0.22
39 0.28
40 0.32
41 0.36
42 0.44
43 0.46
44 0.46
45 0.48
46 0.53
47 0.55
48 0.6
49 0.63
50 0.57
51 0.6
52 0.61
53 0.58
54 0.56
55 0.5
56 0.43
57 0.37
58 0.35
59 0.31
60 0.31
61 0.25
62 0.17
63 0.13
64 0.11
65 0.1
66 0.1
67 0.1
68 0.09
69 0.09
70 0.09
71 0.09
72 0.09
73 0.08
74 0.08
75 0.08
76 0.08
77 0.08
78 0.08
79 0.09
80 0.08
81 0.08
82 0.08
83 0.1
84 0.09
85 0.09
86 0.09
87 0.09
88 0.11
89 0.12
90 0.13
91 0.1
92 0.1
93 0.1
94 0.11
95 0.11
96 0.08
97 0.06
98 0.06
99 0.06
100 0.06
101 0.05
102 0.09
103 0.11
104 0.18
105 0.19
106 0.25
107 0.33
108 0.42
109 0.5
110 0.5
111 0.56
112 0.58
113 0.68
114 0.71
115 0.73
116 0.71
117 0.68
118 0.71
119 0.72
120 0.67
121 0.64
122 0.62
123 0.62
124 0.64
125 0.67
126 0.64
127 0.56
128 0.61
129 0.62
130 0.64
131 0.65
132 0.65
133 0.66
134 0.73
135 0.8
136 0.8
137 0.8
138 0.81
139 0.79
140 0.79
141 0.77
142 0.7
143 0.67
144 0.63
145 0.56
146 0.51
147 0.46
148 0.39