Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8CS53

Protein Details
Accession A0A4Y8CS53    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
58-78CNVGPSAKEKPRRGPRPTKDIHydrophilic
NLS Segment(s)
PositionSequence
65-74KEKPRRGPRP
Subcellular Location(s) cyto 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MQGDDAIAKGSTKLALVEIPWAGIVGCLRLNSARLIIFIGKTCAEVPRIPRQSILILCNVGPSAKEKPRRGPRPTKDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.11
5 0.1
6 0.1
7 0.09
8 0.09
9 0.07
10 0.07
11 0.07
12 0.05
13 0.06
14 0.06
15 0.07
16 0.07
17 0.08
18 0.08
19 0.09
20 0.08
21 0.08
22 0.09
23 0.09
24 0.09
25 0.09
26 0.09
27 0.08
28 0.09
29 0.09
30 0.09
31 0.1
32 0.12
33 0.16
34 0.25
35 0.29
36 0.29
37 0.29
38 0.3
39 0.32
40 0.33
41 0.31
42 0.23
43 0.2
44 0.19
45 0.2
46 0.18
47 0.14
48 0.11
49 0.13
50 0.19
51 0.26
52 0.35
53 0.4
54 0.51
55 0.62
56 0.71
57 0.78
58 0.81