Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A5E2U2

Protein Details
Accession A5E2U2   
Localization Confidence Medium
Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
119-142ISKLKGMMKKKKKTSSKNDNLKEEHydrophilic
NLS Segment(s)
PositionSequence
122-132LKGMMKKKKKT
Subcellular Location(s) nucl 19.5, cyto_nucl 12.333, cyto 4, cyto_pero 2.833
Family & Domain DBs
KEGG lel:LELG_03929  -  
Amino Acid Sequences MTRGADNVDYESDDECEEEEPKEAGKLAGLKAKFSKSKKPFDKEEDEEDEEEKKVDEDCASDFAGEIQEPIDSAEECKDGANDDEKVCEGDIDGKDEKEEEVCDDGEDGDAGDKKTSMISKLKGMMKKKKKTSSKNDNLKEEPDCEVEEEESQEETPKKGGKIAGIKAKFLNLKKPLEGEQEDEEQDEEKGEGEEDTTKIDCKDAKSKDNEKREILHIKGKMYKRGDLILERHYDLSHLFKDDIPKLSLKALQAEAGNPKQPPGQLINSANGDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.11
3 0.12
4 0.12
5 0.12
6 0.13
7 0.12
8 0.13
9 0.14
10 0.14
11 0.12
12 0.14
13 0.17
14 0.17
15 0.24
16 0.23
17 0.26
18 0.3
19 0.37
20 0.42
21 0.43
22 0.51
23 0.53
24 0.64
25 0.7
26 0.73
27 0.75
28 0.75
29 0.8
30 0.74
31 0.73
32 0.69
33 0.63
34 0.56
35 0.49
36 0.42
37 0.33
38 0.28
39 0.21
40 0.14
41 0.11
42 0.11
43 0.1
44 0.1
45 0.11
46 0.13
47 0.13
48 0.12
49 0.12
50 0.11
51 0.11
52 0.1
53 0.08
54 0.06
55 0.05
56 0.06
57 0.06
58 0.07
59 0.06
60 0.07
61 0.08
62 0.09
63 0.09
64 0.09
65 0.09
66 0.09
67 0.1
68 0.13
69 0.13
70 0.13
71 0.14
72 0.14
73 0.15
74 0.13
75 0.11
76 0.08
77 0.12
78 0.12
79 0.16
80 0.17
81 0.16
82 0.16
83 0.17
84 0.17
85 0.11
86 0.11
87 0.08
88 0.09
89 0.09
90 0.09
91 0.09
92 0.09
93 0.08
94 0.07
95 0.06
96 0.05
97 0.07
98 0.07
99 0.07
100 0.07
101 0.07
102 0.09
103 0.09
104 0.12
105 0.15
106 0.16
107 0.19
108 0.25
109 0.3
110 0.33
111 0.4
112 0.47
113 0.53
114 0.6
115 0.66
116 0.69
117 0.74
118 0.79
119 0.82
120 0.83
121 0.84
122 0.85
123 0.82
124 0.79
125 0.7
126 0.63
127 0.54
128 0.44
129 0.35
130 0.26
131 0.21
132 0.16
133 0.15
134 0.12
135 0.11
136 0.1
137 0.09
138 0.08
139 0.08
140 0.1
141 0.1
142 0.1
143 0.11
144 0.13
145 0.13
146 0.15
147 0.16
148 0.19
149 0.25
150 0.29
151 0.35
152 0.34
153 0.35
154 0.32
155 0.35
156 0.35
157 0.3
158 0.34
159 0.32
160 0.33
161 0.33
162 0.35
163 0.34
164 0.35
165 0.35
166 0.3
167 0.27
168 0.27
169 0.26
170 0.24
171 0.22
172 0.16
173 0.14
174 0.11
175 0.08
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.08
182 0.08
183 0.1
184 0.1
185 0.11
186 0.11
187 0.13
188 0.15
189 0.17
190 0.26
191 0.29
192 0.36
193 0.44
194 0.54
195 0.61
196 0.69
197 0.7
198 0.64
199 0.62
200 0.62
201 0.61
202 0.55
203 0.53
204 0.46
205 0.45
206 0.5
207 0.51
208 0.52
209 0.49
210 0.49
211 0.44
212 0.45
213 0.45
214 0.43
215 0.42
216 0.4
217 0.4
218 0.37
219 0.35
220 0.31
221 0.28
222 0.23
223 0.24
224 0.2
225 0.2
226 0.19
227 0.21
228 0.27
229 0.31
230 0.34
231 0.31
232 0.3
233 0.29
234 0.31
235 0.33
236 0.28
237 0.28
238 0.25
239 0.26
240 0.25
241 0.27
242 0.31
243 0.32
244 0.34
245 0.29
246 0.3
247 0.3
248 0.3
249 0.32
250 0.3
251 0.31
252 0.35
253 0.38
254 0.42