Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8CT90

Protein Details
Accession A0A4Y8CT90    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-33IHIPYFRTLSHPKKPKKPKPPTPTTRSIGHydrophilic
NLS Segment(s)
PositionSequence
16-24PKKPKKPKP
Subcellular Location(s) mito 19.5, cyto_mito 11.333, nucl 5.5, cyto_nucl 4.333
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPIHIHIPYFRTLSHPKKPKKPKPPTPTTRSIGTQTTNTRTHSSRWTQTPSRYISFHEQLGVRPPRKSGIERLPWYAVLGGVVLGWFWMGIWGWARCIHKYIHTYNKFNKIQNGRDLETY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.55
3 0.61
4 0.71
5 0.82
6 0.85
7 0.88
8 0.9
9 0.91
10 0.91
11 0.93
12 0.92
13 0.89
14 0.87
15 0.79
16 0.72
17 0.64
18 0.57
19 0.49
20 0.42
21 0.4
22 0.35
23 0.38
24 0.36
25 0.35
26 0.35
27 0.33
28 0.34
29 0.36
30 0.37
31 0.37
32 0.39
33 0.44
34 0.45
35 0.47
36 0.5
37 0.47
38 0.44
39 0.39
40 0.37
41 0.36
42 0.33
43 0.29
44 0.26
45 0.22
46 0.2
47 0.27
48 0.31
49 0.26
50 0.25
51 0.25
52 0.26
53 0.29
54 0.31
55 0.3
56 0.32
57 0.4
58 0.41
59 0.44
60 0.42
61 0.39
62 0.37
63 0.3
64 0.2
65 0.11
66 0.09
67 0.06
68 0.04
69 0.04
70 0.03
71 0.03
72 0.03
73 0.02
74 0.02
75 0.03
76 0.03
77 0.04
78 0.08
79 0.08
80 0.1
81 0.15
82 0.18
83 0.18
84 0.21
85 0.21
86 0.25
87 0.31
88 0.38
89 0.44
90 0.49
91 0.56
92 0.62
93 0.7
94 0.69
95 0.67
96 0.69
97 0.67
98 0.65
99 0.67
100 0.66