Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8D4J9

Protein Details
Accession A0A4Y8D4J9    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MPISKKDRIAREHKKADKECTRBasic
NLS Segment(s)
Subcellular Location(s) mito 11.5, mito_nucl 11.166, nucl 9.5, cyto_nucl 8.333, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR026939  ZNF706/At2g23090_sf  
Amino Acid Sequences MPISKKDRIAREHKKADKECTRAPVKANGLPVKAAAPKSKCEFCKMELVNTNKAQLISHATKHEDKGWTKEKCWPNDFTA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.81
4 0.79
5 0.75
6 0.69
7 0.67
8 0.64
9 0.57
10 0.54
11 0.52
12 0.47
13 0.43
14 0.45
15 0.4
16 0.36
17 0.33
18 0.31
19 0.25
20 0.23
21 0.22
22 0.21
23 0.19
24 0.22
25 0.26
26 0.31
27 0.29
28 0.31
29 0.32
30 0.29
31 0.36
32 0.33
33 0.34
34 0.36
35 0.39
36 0.4
37 0.39
38 0.38
39 0.3
40 0.3
41 0.24
42 0.19
43 0.23
44 0.2
45 0.22
46 0.24
47 0.27
48 0.3
49 0.32
50 0.36
51 0.36
52 0.36
53 0.41
54 0.47
55 0.48
56 0.47
57 0.55
58 0.58
59 0.6
60 0.61