Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8CN83

Protein Details
Accession A0A4Y8CN83    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
67-89DEDDRRRQERRARRDANRRFDEQBasic
NLS Segment(s)
PositionSequence
76-77RR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences RGERERRGVEEDRRRKGVEEDDGDGDDDERAYRHRRERVREEEDRRETRGMRYGHDSYERTRRETHDEDDRRRQERRARRDANRRFDEQYEIEEVPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.59
3 0.56
4 0.53
5 0.51
6 0.45
7 0.41
8 0.38
9 0.38
10 0.36
11 0.31
12 0.24
13 0.15
14 0.11
15 0.08
16 0.07
17 0.09
18 0.13
19 0.19
20 0.26
21 0.34
22 0.41
23 0.49
24 0.58
25 0.64
26 0.68
27 0.71
28 0.71
29 0.72
30 0.73
31 0.67
32 0.6
33 0.53
34 0.46
35 0.39
36 0.39
37 0.3
38 0.24
39 0.28
40 0.27
41 0.27
42 0.3
43 0.3
44 0.26
45 0.35
46 0.34
47 0.31
48 0.33
49 0.34
50 0.37
51 0.4
52 0.41
53 0.43
54 0.49
55 0.53
56 0.61
57 0.65
58 0.61
59 0.6
60 0.63
61 0.62
62 0.64
63 0.67
64 0.68
65 0.7
66 0.76
67 0.84
68 0.88
69 0.88
70 0.84
71 0.79
72 0.72
73 0.65
74 0.62
75 0.52
76 0.46
77 0.41