Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8CM97

Protein Details
Accession A0A4Y8CM97    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
76-101FKDINKSYRRSEKKNRQRLKFTNTIHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 12, cyto 5, mito 4
Family & Domain DBs
Amino Acid Sequences MSLKYCFNQPYTERPRIPEMNFENRSLNPDQNSPTNRRIEIESNGKQPEGYKAIEKNITIMAEICILKSRLGAHYFKDINKSYRRSEKKNRQRLKFTNTIHLHIASRVNKDFKFEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.59
3 0.58
4 0.56
5 0.55
6 0.53
7 0.54
8 0.54
9 0.52
10 0.47
11 0.41
12 0.45
13 0.38
14 0.35
15 0.27
16 0.28
17 0.29
18 0.33
19 0.37
20 0.38
21 0.4
22 0.4
23 0.39
24 0.37
25 0.38
26 0.34
27 0.35
28 0.39
29 0.36
30 0.37
31 0.37
32 0.35
33 0.32
34 0.29
35 0.27
36 0.21
37 0.19
38 0.17
39 0.18
40 0.21
41 0.22
42 0.22
43 0.19
44 0.17
45 0.16
46 0.12
47 0.11
48 0.09
49 0.09
50 0.09
51 0.08
52 0.09
53 0.09
54 0.09
55 0.1
56 0.11
57 0.12
58 0.15
59 0.17
60 0.17
61 0.24
62 0.26
63 0.27
64 0.32
65 0.32
66 0.34
67 0.41
68 0.43
69 0.42
70 0.51
71 0.57
72 0.6
73 0.69
74 0.74
75 0.78
76 0.84
77 0.87
78 0.86
79 0.89
80 0.88
81 0.85
82 0.83
83 0.76
84 0.76
85 0.69
86 0.64
87 0.56
88 0.49
89 0.42
90 0.35
91 0.4
92 0.33
93 0.36
94 0.38
95 0.41
96 0.4