Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8CDP8

Protein Details
Accession A0A4Y8CDP8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
46-84KTDVSKPKKDDKCKSCEKKKEKGEKKKEKKKSDGGCIVSBasic
NLS Segment(s)
PositionSequence
62-76EKKKEKGEKKKEKKK
Subcellular Location(s) nucl 13.5, cyto_nucl 9, mito 8, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MPADWRTDKSGNVKGFIRRKGDPNPLNWGYEVDDKVLSHPKAAMIKTDVSKPKKDDKCKSCEKKKEKGEKKKEKKKSDGGCIVS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.52
3 0.53
4 0.52
5 0.47
6 0.51
7 0.55
8 0.61
9 0.57
10 0.52
11 0.55
12 0.51
13 0.49
14 0.43
15 0.36
16 0.28
17 0.28
18 0.25
19 0.17
20 0.16
21 0.15
22 0.17
23 0.22
24 0.19
25 0.15
26 0.15
27 0.16
28 0.19
29 0.19
30 0.19
31 0.14
32 0.17
33 0.18
34 0.24
35 0.29
36 0.29
37 0.33
38 0.36
39 0.44
40 0.51
41 0.59
42 0.63
43 0.63
44 0.68
45 0.75
46 0.82
47 0.82
48 0.84
49 0.82
50 0.82
51 0.85
52 0.88
53 0.88
54 0.89
55 0.9
56 0.9
57 0.94
58 0.95
59 0.95
60 0.94
61 0.93
62 0.92
63 0.9
64 0.89