Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8D910

Protein Details
Accession A0A4Y8D910    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MKKEGKKTSQHNLRNTRKYRHRQILKTVIEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
Amino Acid Sequences MKKEGKKTSQHNLRNTRKYRHRQILKTVIEPAESPDGGDEKNAGDAENQGEGVQDTDEEVLEDFEGAEIEGHGAGAGGGGGWILLVRLLASRGMHARSHVRDCEEGCVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.84
4 0.84
5 0.86
6 0.86
7 0.87
8 0.86
9 0.82
10 0.85
11 0.85
12 0.79
13 0.71
14 0.65
15 0.55
16 0.45
17 0.38
18 0.31
19 0.25
20 0.2
21 0.17
22 0.13
23 0.13
24 0.12
25 0.12
26 0.1
27 0.06
28 0.08
29 0.08
30 0.08
31 0.07
32 0.08
33 0.09
34 0.08
35 0.08
36 0.06
37 0.06
38 0.06
39 0.06
40 0.05
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.02
72 0.02
73 0.03
74 0.03
75 0.05
76 0.07
77 0.07
78 0.1
79 0.13
80 0.16
81 0.17
82 0.2
83 0.28
84 0.32
85 0.38
86 0.4
87 0.41
88 0.42
89 0.43