Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8CV88

Protein Details
Accession A0A4Y8CV88    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
284-305ANGTDSKKKPGRPKGASNGTPAHydrophilic
NLS Segment(s)
PositionSequence
245-254EAKSKAGSKR
290-327KKKPGRPKGASNGTPAKREKKIPAVGQAQRKTRSQARK
Subcellular Location(s) nucl 16.5, cyto_nucl 13.333, cyto 7, cyto_pero 4.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR021331  Hva1_TUDOR  
Pfam View protein in Pfam  
PF11160  Hva1_TUDOR  
Amino Acid Sequences MADNKIEEGDKVSWSWGGANPDGTAAEVKAGEVSVTSHRGNEIKKTGDEKNPAVHIERSGNDVVKLASELKVEDKGEESKEGEETKDEEETKEEENANESKKTKEDTKEDTNGEVEDGEKMDETNGEAKNEDKKDETNGDSKDEVNGDSQDKTNGETKVEEEKAETNGESKDEEMKDETNVPDENVESEEDNKKAEDVEMKDGDDKVEEKTTKENPEEKSEEKSEEKNVKEDEKKDSNDKEDKPEAKSKAGSKRKADELDDEAESPDENSTKKQKTNATSNGNANGTDSKKKPGRPKGASNGTPAKREKKIPAVGQAQRKTRSQARKESV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.19
3 0.18
4 0.21
5 0.21
6 0.22
7 0.21
8 0.21
9 0.21
10 0.19
11 0.16
12 0.11
13 0.11
14 0.1
15 0.09
16 0.09
17 0.09
18 0.08
19 0.07
20 0.09
21 0.11
22 0.16
23 0.16
24 0.16
25 0.19
26 0.24
27 0.26
28 0.31
29 0.33
30 0.33
31 0.37
32 0.42
33 0.46
34 0.49
35 0.53
36 0.49
37 0.48
38 0.47
39 0.45
40 0.43
41 0.38
42 0.33
43 0.32
44 0.3
45 0.28
46 0.28
47 0.27
48 0.23
49 0.23
50 0.19
51 0.15
52 0.16
53 0.13
54 0.12
55 0.11
56 0.12
57 0.13
58 0.17
59 0.17
60 0.16
61 0.18
62 0.19
63 0.2
64 0.22
65 0.21
66 0.18
67 0.2
68 0.2
69 0.18
70 0.17
71 0.17
72 0.16
73 0.19
74 0.19
75 0.17
76 0.18
77 0.2
78 0.2
79 0.21
80 0.2
81 0.16
82 0.19
83 0.22
84 0.22
85 0.24
86 0.24
87 0.22
88 0.24
89 0.28
90 0.31
91 0.35
92 0.39
93 0.42
94 0.48
95 0.52
96 0.51
97 0.48
98 0.42
99 0.35
100 0.29
101 0.22
102 0.14
103 0.09
104 0.08
105 0.07
106 0.06
107 0.06
108 0.05
109 0.06
110 0.06
111 0.11
112 0.12
113 0.12
114 0.12
115 0.14
116 0.21
117 0.22
118 0.22
119 0.19
120 0.19
121 0.22
122 0.26
123 0.27
124 0.25
125 0.25
126 0.27
127 0.26
128 0.25
129 0.22
130 0.19
131 0.17
132 0.12
133 0.13
134 0.12
135 0.12
136 0.12
137 0.12
138 0.12
139 0.13
140 0.16
141 0.15
142 0.15
143 0.14
144 0.16
145 0.21
146 0.21
147 0.19
148 0.16
149 0.17
150 0.17
151 0.17
152 0.15
153 0.1
154 0.1
155 0.11
156 0.1
157 0.09
158 0.12
159 0.12
160 0.13
161 0.13
162 0.13
163 0.13
164 0.15
165 0.15
166 0.12
167 0.12
168 0.11
169 0.1
170 0.1
171 0.1
172 0.08
173 0.09
174 0.07
175 0.1
176 0.12
177 0.12
178 0.13
179 0.12
180 0.11
181 0.11
182 0.11
183 0.13
184 0.14
185 0.19
186 0.19
187 0.2
188 0.21
189 0.21
190 0.2
191 0.16
192 0.14
193 0.11
194 0.16
195 0.16
196 0.16
197 0.21
198 0.26
199 0.3
200 0.34
201 0.38
202 0.35
203 0.41
204 0.45
205 0.41
206 0.42
207 0.39
208 0.39
209 0.36
210 0.36
211 0.36
212 0.39
213 0.38
214 0.38
215 0.38
216 0.42
217 0.44
218 0.45
219 0.45
220 0.45
221 0.48
222 0.5
223 0.51
224 0.51
225 0.54
226 0.53
227 0.53
228 0.54
229 0.54
230 0.53
231 0.56
232 0.52
233 0.48
234 0.5
235 0.5
236 0.53
237 0.59
238 0.61
239 0.6
240 0.63
241 0.66
242 0.66
243 0.61
244 0.55
245 0.5
246 0.46
247 0.41
248 0.35
249 0.27
250 0.23
251 0.2
252 0.16
253 0.13
254 0.1
255 0.1
256 0.15
257 0.24
258 0.29
259 0.33
260 0.39
261 0.46
262 0.52
263 0.61
264 0.65
265 0.64
266 0.64
267 0.65
268 0.64
269 0.57
270 0.49
271 0.41
272 0.38
273 0.34
274 0.35
275 0.33
276 0.36
277 0.41
278 0.49
279 0.57
280 0.62
281 0.7
282 0.7
283 0.79
284 0.8
285 0.85
286 0.81
287 0.78
288 0.78
289 0.7
290 0.69
291 0.66
292 0.63
293 0.58
294 0.62
295 0.62
296 0.61
297 0.67
298 0.65
299 0.68
300 0.7
301 0.71
302 0.75
303 0.75
304 0.73
305 0.68
306 0.66
307 0.64
308 0.64
309 0.67
310 0.66