Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8CT26

Protein Details
Accession A0A4Y8CT26    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
2-30QYQVVALKLGKKRKKREKGRNMCEKGPFRHydrophilic
NLS Segment(s)
PositionSequence
10-21LGKKRKKREKGR
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MQYQVVALKLGKKRKKREKGRNMCEKGPFRENTIQRARGVERMKKHQATSDERRAATPAPILAQETNLIGLKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.81
3 0.85
4 0.89
5 0.91
6 0.93
7 0.94
8 0.94
9 0.89
10 0.83
11 0.81
12 0.75
13 0.68
14 0.64
15 0.54
16 0.49
17 0.51
18 0.48
19 0.47
20 0.48
21 0.45
22 0.38
23 0.4
24 0.36
25 0.34
26 0.38
27 0.35
28 0.33
29 0.39
30 0.47
31 0.47
32 0.46
33 0.45
34 0.47
35 0.51
36 0.54
37 0.56
38 0.54
39 0.51
40 0.51
41 0.48
42 0.42
43 0.36
44 0.29
45 0.2
46 0.16
47 0.17
48 0.18
49 0.17
50 0.16
51 0.15
52 0.13
53 0.15