Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8D864

Protein Details
Accession A0A4Y8D864    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
26-46PINNHLKKEKRGNPKPPFPIQHydrophilic
NLS Segment(s)
PositionSequence
32-50KKEKRGNPKPPFPIQKEAK
Subcellular Location(s) nucl 21, cyto_nucl 12, mito 5
Family & Domain DBs
Amino Acid Sequences MYIVKDKFRRATLKKNDSEGQVTNQPINNHLKKEKRGNPKPPFPIQKEAKTPKEAEATRRPLSSEYSNLFERMNISKTTSFRGLASEVKGERDGVSYPLTPFAKVKREL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.73
3 0.71
4 0.64
5 0.62
6 0.53
7 0.47
8 0.43
9 0.39
10 0.35
11 0.35
12 0.31
13 0.31
14 0.37
15 0.36
16 0.35
17 0.41
18 0.45
19 0.49
20 0.59
21 0.63
22 0.66
23 0.72
24 0.78
25 0.79
26 0.81
27 0.81
28 0.79
29 0.79
30 0.72
31 0.72
32 0.67
33 0.63
34 0.64
35 0.64
36 0.6
37 0.55
38 0.51
39 0.44
40 0.46
41 0.41
42 0.38
43 0.4
44 0.42
45 0.41
46 0.4
47 0.37
48 0.31
49 0.34
50 0.3
51 0.26
52 0.21
53 0.23
54 0.23
55 0.24
56 0.22
57 0.19
58 0.19
59 0.17
60 0.18
61 0.15
62 0.18
63 0.21
64 0.22
65 0.26
66 0.26
67 0.24
68 0.22
69 0.24
70 0.23
71 0.22
72 0.23
73 0.24
74 0.22
75 0.24
76 0.24
77 0.22
78 0.2
79 0.19
80 0.18
81 0.15
82 0.17
83 0.17
84 0.17
85 0.24
86 0.24
87 0.23
88 0.26
89 0.3