Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8D1I3

Protein Details
Accession A0A4Y8D1I3    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
453-472DRPMKVWPGKKDNRRGYSERBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13.333, cyto 12, nucl 11.5, cyto_mito 7.499
Family & Domain DBs
InterPro View protein in InterPro  
IPR037221  H-type_lectin_dom_sf  
IPR019019  H-type_lectin_domain  
IPR024079  MetalloPept_cat_dom_sf  
IPR001506  Peptidase_M12A  
IPR006026  Peptidase_Metallo  
Gene Ontology GO:0030246  F:carbohydrate binding  
GO:0004222  F:metalloendopeptidase activity  
GO:0008270  F:zinc ion binding  
GO:0007155  P:cell adhesion  
GO:0006508  P:proteolysis  
Pfam View protein in Pfam  
PF01400  Astacin  
PF09458  H_lectin  
Amino Acid Sequences MSIPISADDLHEVHTCAILRPTSGTPLPPSGEKRDSGGFDYLVLDPKFYWNPGDELTVSFIKPDPKDMIINDWNSLKKKVENIAREWEEVANIRFTFNDSSDAQVRVGFFPGAGGFSALGTDCTSIKPGDPTMSLGRSTDDKTFRSSVLHEFGHVLGCLHEHSSPLSDIQWNDEEVYLFYKSKHKKDKIWVDEQILKPLKEYETDHSSFDSSSIMIYPIDKALTKNGVSIKLPLEISLKDKAFLQQIYPPHSVPDTVGVFYSWNYKKWDRRDPKNTAFVPFASELTTATPAVAVGLVQFDMDFKVPLRVKATAACVTSQSFNIQTETWDGSDGLLSAGATWFKIDDPKNSDFRTGMFDTAGYQPDREPMSNFKWTIKFKRAFESPPEVVVWIRGFYIETGTDIGLTVSAHDITKSSFEIHIDPIGNTKLHRAMATWIAYPKDKKGVFSGNTVDRPMKVWPGKKDNRRGYSERFDLTDRLEQQNCDWTKFRVWAGVNSFDISGERNIRLHTEVEKMDRDVCENSFWIHVKTWSDTDCRSASSSYLAVFEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.18
3 0.17
4 0.21
5 0.18
6 0.18
7 0.21
8 0.22
9 0.25
10 0.26
11 0.28
12 0.27
13 0.31
14 0.33
15 0.35
16 0.39
17 0.41
18 0.43
19 0.41
20 0.41
21 0.42
22 0.42
23 0.4
24 0.38
25 0.3
26 0.26
27 0.28
28 0.25
29 0.27
30 0.24
31 0.21
32 0.18
33 0.23
34 0.25
35 0.23
36 0.24
37 0.19
38 0.22
39 0.23
40 0.26
41 0.21
42 0.2
43 0.24
44 0.23
45 0.21
46 0.19
47 0.2
48 0.23
49 0.23
50 0.27
51 0.26
52 0.27
53 0.31
54 0.31
55 0.37
56 0.36
57 0.38
58 0.35
59 0.36
60 0.38
61 0.37
62 0.39
63 0.34
64 0.32
65 0.36
66 0.42
67 0.46
68 0.48
69 0.5
70 0.56
71 0.56
72 0.54
73 0.49
74 0.41
75 0.34
76 0.31
77 0.28
78 0.22
79 0.19
80 0.18
81 0.17
82 0.19
83 0.2
84 0.17
85 0.2
86 0.17
87 0.21
88 0.23
89 0.25
90 0.22
91 0.21
92 0.21
93 0.18
94 0.19
95 0.15
96 0.11
97 0.11
98 0.11
99 0.1
100 0.08
101 0.08
102 0.06
103 0.06
104 0.07
105 0.06
106 0.06
107 0.06
108 0.07
109 0.07
110 0.08
111 0.1
112 0.1
113 0.11
114 0.13
115 0.14
116 0.15
117 0.16
118 0.19
119 0.22
120 0.23
121 0.22
122 0.2
123 0.21
124 0.21
125 0.22
126 0.25
127 0.25
128 0.24
129 0.28
130 0.3
131 0.29
132 0.28
133 0.28
134 0.26
135 0.27
136 0.26
137 0.22
138 0.22
139 0.21
140 0.21
141 0.18
142 0.13
143 0.08
144 0.09
145 0.09
146 0.09
147 0.08
148 0.08
149 0.08
150 0.1
151 0.11
152 0.11
153 0.12
154 0.13
155 0.13
156 0.16
157 0.17
158 0.15
159 0.16
160 0.15
161 0.14
162 0.12
163 0.14
164 0.12
165 0.11
166 0.12
167 0.2
168 0.26
169 0.35
170 0.45
171 0.49
172 0.55
173 0.65
174 0.74
175 0.73
176 0.75
177 0.7
178 0.65
179 0.67
180 0.59
181 0.58
182 0.51
183 0.43
184 0.35
185 0.33
186 0.29
187 0.24
188 0.26
189 0.22
190 0.26
191 0.27
192 0.27
193 0.25
194 0.25
195 0.22
196 0.2
197 0.15
198 0.08
199 0.07
200 0.07
201 0.06
202 0.06
203 0.06
204 0.06
205 0.07
206 0.07
207 0.08
208 0.08
209 0.1
210 0.13
211 0.13
212 0.16
213 0.18
214 0.19
215 0.19
216 0.21
217 0.19
218 0.19
219 0.18
220 0.16
221 0.15
222 0.14
223 0.16
224 0.19
225 0.18
226 0.16
227 0.16
228 0.17
229 0.18
230 0.18
231 0.16
232 0.16
233 0.19
234 0.25
235 0.26
236 0.24
237 0.22
238 0.22
239 0.21
240 0.16
241 0.18
242 0.13
243 0.11
244 0.11
245 0.1
246 0.1
247 0.1
248 0.18
249 0.15
250 0.17
251 0.21
252 0.26
253 0.32
254 0.39
255 0.5
256 0.51
257 0.6
258 0.67
259 0.71
260 0.72
261 0.75
262 0.69
263 0.6
264 0.53
265 0.42
266 0.36
267 0.28
268 0.22
269 0.14
270 0.13
271 0.1
272 0.1
273 0.11
274 0.08
275 0.07
276 0.06
277 0.05
278 0.05
279 0.05
280 0.04
281 0.03
282 0.03
283 0.03
284 0.03
285 0.03
286 0.03
287 0.04
288 0.04
289 0.05
290 0.05
291 0.12
292 0.12
293 0.14
294 0.17
295 0.17
296 0.18
297 0.2
298 0.24
299 0.21
300 0.21
301 0.2
302 0.18
303 0.18
304 0.18
305 0.16
306 0.14
307 0.11
308 0.11
309 0.12
310 0.11
311 0.11
312 0.12
313 0.13
314 0.12
315 0.11
316 0.11
317 0.09
318 0.09
319 0.09
320 0.06
321 0.05
322 0.04
323 0.04
324 0.04
325 0.04
326 0.04
327 0.04
328 0.04
329 0.05
330 0.11
331 0.13
332 0.17
333 0.24
334 0.28
335 0.33
336 0.34
337 0.35
338 0.29
339 0.29
340 0.3
341 0.25
342 0.21
343 0.16
344 0.15
345 0.16
346 0.18
347 0.2
348 0.14
349 0.13
350 0.13
351 0.16
352 0.19
353 0.17
354 0.17
355 0.2
356 0.24
357 0.3
358 0.31
359 0.31
360 0.36
361 0.42
362 0.47
363 0.51
364 0.52
365 0.49
366 0.55
367 0.55
368 0.52
369 0.52
370 0.53
371 0.44
372 0.39
373 0.37
374 0.31
375 0.26
376 0.25
377 0.19
378 0.11
379 0.1
380 0.09
381 0.09
382 0.08
383 0.1
384 0.08
385 0.08
386 0.09
387 0.09
388 0.08
389 0.08
390 0.08
391 0.06
392 0.06
393 0.06
394 0.05
395 0.06
396 0.06
397 0.07
398 0.07
399 0.08
400 0.1
401 0.1
402 0.11
403 0.11
404 0.13
405 0.15
406 0.16
407 0.19
408 0.18
409 0.17
410 0.19
411 0.2
412 0.19
413 0.17
414 0.19
415 0.19
416 0.19
417 0.19
418 0.17
419 0.19
420 0.24
421 0.26
422 0.25
423 0.24
424 0.25
425 0.29
426 0.3
427 0.3
428 0.33
429 0.31
430 0.31
431 0.34
432 0.41
433 0.38
434 0.42
435 0.45
436 0.43
437 0.44
438 0.45
439 0.4
440 0.32
441 0.32
442 0.29
443 0.32
444 0.32
445 0.37
446 0.43
447 0.53
448 0.62
449 0.7
450 0.78
451 0.79
452 0.8
453 0.81
454 0.79
455 0.76
456 0.76
457 0.72
458 0.63
459 0.56
460 0.51
461 0.45
462 0.43
463 0.42
464 0.37
465 0.38
466 0.38
467 0.36
468 0.36
469 0.43
470 0.4
471 0.37
472 0.35
473 0.32
474 0.34
475 0.37
476 0.36
477 0.34
478 0.35
479 0.37
480 0.4
481 0.43
482 0.39
483 0.36
484 0.35
485 0.28
486 0.26
487 0.21
488 0.21
489 0.19
490 0.2
491 0.2
492 0.21
493 0.24
494 0.25
495 0.26
496 0.24
497 0.26
498 0.28
499 0.32
500 0.34
501 0.33
502 0.35
503 0.34
504 0.34
505 0.31
506 0.28
507 0.26
508 0.24
509 0.24
510 0.25
511 0.26
512 0.26
513 0.25
514 0.28
515 0.28
516 0.31
517 0.34
518 0.32
519 0.35
520 0.34
521 0.37
522 0.34
523 0.33
524 0.32
525 0.29
526 0.26
527 0.25
528 0.25
529 0.2