Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8CER8

Protein Details
Accession A0A4Y8CER8    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
124-145GSEYKGKQSAGSKKKRKSKSLKBasic
NLS Segment(s)
PositionSequence
130-145KQSAGSKKKRKSKSLK
Subcellular Location(s) nucl 15.5, mito_nucl 12.166, cyto_nucl 10.833, mito 7.5
Family & Domain DBs
Amino Acid Sequences MSSFSRSLEKPKTLCSQSISPSSSKAMNAGMFIVNVDRGKALHVCGTISPSDGSYPDEDASFDGDYPDGSDVDALEDDDDNLLPFEDELDEKHYLSLEAECFSERVTKTPATKSDQVIELSSSGSEYKGKQSAGSKKKRKSKSLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.5
3 0.48
4 0.45
5 0.5
6 0.47
7 0.39
8 0.38
9 0.37
10 0.33
11 0.27
12 0.24
13 0.2
14 0.18
15 0.17
16 0.16
17 0.14
18 0.12
19 0.12
20 0.11
21 0.1
22 0.09
23 0.09
24 0.08
25 0.08
26 0.1
27 0.1
28 0.11
29 0.11
30 0.12
31 0.12
32 0.12
33 0.14
34 0.13
35 0.13
36 0.12
37 0.09
38 0.1
39 0.09
40 0.11
41 0.1
42 0.11
43 0.1
44 0.1
45 0.1
46 0.09
47 0.1
48 0.09
49 0.08
50 0.07
51 0.06
52 0.06
53 0.06
54 0.07
55 0.05
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.04
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.04
70 0.03
71 0.03
72 0.04
73 0.04
74 0.04
75 0.05
76 0.09
77 0.1
78 0.1
79 0.11
80 0.1
81 0.1
82 0.11
83 0.11
84 0.08
85 0.08
86 0.09
87 0.09
88 0.09
89 0.1
90 0.14
91 0.13
92 0.15
93 0.18
94 0.22
95 0.25
96 0.31
97 0.36
98 0.38
99 0.42
100 0.42
101 0.42
102 0.42
103 0.39
104 0.34
105 0.3
106 0.23
107 0.19
108 0.16
109 0.13
110 0.1
111 0.1
112 0.11
113 0.12
114 0.17
115 0.21
116 0.21
117 0.25
118 0.33
119 0.43
120 0.51
121 0.61
122 0.65
123 0.7
124 0.8
125 0.86