Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8DGG3

Protein Details
Accession A0A4Y8DGG3    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
82-108VSWPKSKIQNPRKGKGKIRRDVRNAIGHydrophilic
NLS Segment(s)
PositionSequence
89-101IQNPRKGKGKIRR
Subcellular Location(s) nucl 10.5, cyto_nucl 9, mito 8, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MPTLGDWLYFTYYRGKEEGPTEHSAACLHINEQEVPPVLVPPWPDNAQSARCTVPPYRWTMSMQSPSQKMLNGKLLLLPTTVSWPKSKIQNPRKGKGKIRRDVRNAIGQCQLGTKVLRNRIAFYN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.25
3 0.25
4 0.29
5 0.34
6 0.31
7 0.34
8 0.33
9 0.31
10 0.31
11 0.27
12 0.24
13 0.2
14 0.15
15 0.11
16 0.13
17 0.15
18 0.15
19 0.15
20 0.16
21 0.15
22 0.15
23 0.14
24 0.12
25 0.1
26 0.1
27 0.11
28 0.11
29 0.14
30 0.15
31 0.15
32 0.17
33 0.2
34 0.21
35 0.21
36 0.21
37 0.18
38 0.18
39 0.2
40 0.19
41 0.22
42 0.22
43 0.26
44 0.26
45 0.26
46 0.27
47 0.28
48 0.31
49 0.31
50 0.29
51 0.27
52 0.26
53 0.26
54 0.25
55 0.24
56 0.21
57 0.19
58 0.24
59 0.2
60 0.19
61 0.2
62 0.19
63 0.17
64 0.16
65 0.14
66 0.08
67 0.12
68 0.14
69 0.13
70 0.14
71 0.16
72 0.2
73 0.28
74 0.34
75 0.4
76 0.49
77 0.58
78 0.65
79 0.72
80 0.78
81 0.77
82 0.81
83 0.81
84 0.81
85 0.8
86 0.82
87 0.82
88 0.8
89 0.8
90 0.75
91 0.75
92 0.66
93 0.6
94 0.55
95 0.46
96 0.39
97 0.33
98 0.29
99 0.22
100 0.23
101 0.26
102 0.29
103 0.36
104 0.43
105 0.43