Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8CTN4

Protein Details
Accession A0A4Y8CTN4   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
58-84NERIRQSEEKSRRKKERDPPYNSPDQPHydrophilic
NLS Segment(s)
PositionSequence
69-72RRKK
Subcellular Location(s) nucl 20, cyto_nucl 12.833, cyto_mito 4.166, mito 3.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MNLEKWSNRRVSDMAYSVGETTLMYFKFESLALGECGAVNRGKCDDDGDVDSFTYTYNERIRQSEEKSRRKKERDPPYNSPDQPKPQSKSTIHNITFSEKQGDGKKHE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.29
3 0.28
4 0.24
5 0.22
6 0.18
7 0.11
8 0.1
9 0.11
10 0.1
11 0.11
12 0.11
13 0.11
14 0.12
15 0.12
16 0.1
17 0.08
18 0.1
19 0.09
20 0.09
21 0.09
22 0.08
23 0.08
24 0.09
25 0.09
26 0.08
27 0.08
28 0.1
29 0.1
30 0.1
31 0.12
32 0.11
33 0.12
34 0.14
35 0.14
36 0.13
37 0.13
38 0.12
39 0.1
40 0.1
41 0.08
42 0.06
43 0.08
44 0.11
45 0.14
46 0.16
47 0.18
48 0.23
49 0.27
50 0.32
51 0.39
52 0.46
53 0.53
54 0.62
55 0.7
56 0.74
57 0.77
58 0.81
59 0.81
60 0.83
61 0.83
62 0.82
63 0.82
64 0.79
65 0.81
66 0.74
67 0.71
68 0.67
69 0.65
70 0.64
71 0.64
72 0.62
73 0.58
74 0.64
75 0.6
76 0.61
77 0.61
78 0.63
79 0.56
80 0.55
81 0.52
82 0.49
83 0.49
84 0.44
85 0.39
86 0.3
87 0.34
88 0.38