Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Y8D772

Protein Details
Accession A0A4Y8D772    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
62-84NIPGRKARKSKAFRTKLQKVANSHydrophilic
NLS Segment(s)
PositionSequence
66-73RKARKSKA
Subcellular Location(s) extr 7, E.R. 6, mito 5, golg 4, plas 3, cyto_mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007568  RTA1  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF04479  RTA1  
Amino Acid Sequences MALALCPIRIIFRLVEYSQGLKSSIPNHEAFQYSLDSVPMLFALVILNIFHPGRIMADSDSNIPGRKARKSKAFRTKLQKVANSDIDDVPMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.22
3 0.22
4 0.23
5 0.22
6 0.22
7 0.2
8 0.15
9 0.18
10 0.19
11 0.21
12 0.22
13 0.23
14 0.23
15 0.24
16 0.25
17 0.23
18 0.2
19 0.17
20 0.14
21 0.13
22 0.12
23 0.09
24 0.08
25 0.07
26 0.05
27 0.04
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.06
42 0.07
43 0.07
44 0.08
45 0.09
46 0.11
47 0.13
48 0.13
49 0.13
50 0.13
51 0.16
52 0.19
53 0.27
54 0.33
55 0.38
56 0.48
57 0.55
58 0.66
59 0.73
60 0.77
61 0.77
62 0.8
63 0.83
64 0.82
65 0.82
66 0.77
67 0.73
68 0.72
69 0.7
70 0.63
71 0.57
72 0.48