Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8CUL0

Protein Details
Accession A0A4Y8CUL0   
Localization Confidence High
Confidence Score 16.8
NoLS Segment(s)
PositionSequenceProtein Nature
7-40QDGNEEKGREKKNREKTEKKQRKNREEIEKKAGEBasic
NLS Segment(s)
PositionSequence
13-42KGREKKNREKTEKKQRKNREEIEKKAGEAR
Subcellular Location(s) nucl 22, cyto 3
Family & Domain DBs
Amino Acid Sequences MARQWKQDGNEEKGREKKNREKTEKKQRKNREEIEKKAGEAREQEKQENKKAVTYPRPLRVACSSIEKVVYLGADPGDQCDRLGMSYLQMIG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.64
3 0.66
4 0.68
5 0.71
6 0.78
7 0.81
8 0.83
9 0.87
10 0.9
11 0.92
12 0.92
13 0.91
14 0.91
15 0.91
16 0.91
17 0.89
18 0.89
19 0.87
20 0.83
21 0.81
22 0.71
23 0.61
24 0.56
25 0.47
26 0.38
27 0.33
28 0.3
29 0.28
30 0.29
31 0.31
32 0.33
33 0.37
34 0.4
35 0.41
36 0.39
37 0.35
38 0.37
39 0.41
40 0.42
41 0.47
42 0.48
43 0.49
44 0.53
45 0.49
46 0.49
47 0.46
48 0.4
49 0.33
50 0.34
51 0.29
52 0.26
53 0.26
54 0.22
55 0.18
56 0.17
57 0.16
58 0.09
59 0.08
60 0.07
61 0.08
62 0.08
63 0.11
64 0.12
65 0.13
66 0.12
67 0.13
68 0.13
69 0.12
70 0.16
71 0.13
72 0.12