Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8DDA0

Protein Details
Accession A0A4Y8DDA0    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
33-63VPDRLDKRKEEEKKRKVKRGKQDSKKSILSIBasic
NLS Segment(s)
PositionSequence
39-58KRKEEEKKRKVKRGKQDSKK
Subcellular Location(s) cyto_nucl 15, nucl 12.5, cyto 8.5, mito 5
Family & Domain DBs
Amino Acid Sequences MISHKDQSTCTIVSRVSAVSLDFEVESGVHQDVPDRLDKRKEEEKKRKVKRGKQDSKKSILSIPGGIGKY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.18
3 0.14
4 0.13
5 0.11
6 0.1
7 0.1
8 0.1
9 0.08
10 0.07
11 0.07
12 0.06
13 0.06
14 0.06
15 0.06
16 0.06
17 0.06
18 0.07
19 0.07
20 0.09
21 0.14
22 0.14
23 0.16
24 0.22
25 0.23
26 0.28
27 0.37
28 0.45
29 0.51
30 0.61
31 0.69
32 0.75
33 0.83
34 0.88
35 0.88
36 0.88
37 0.88
38 0.89
39 0.9
40 0.9
41 0.91
42 0.89
43 0.87
44 0.81
45 0.73
46 0.65
47 0.59
48 0.51
49 0.41
50 0.35