Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8DEM9

Protein Details
Accession A0A4Y8DEM9    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
31-51SSQQVRGKKKLAKEKDHNVTIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13.166, cyto_nucl 2.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR000244  Ribosomal_L9  
IPR009027  Ribosomal_L9/RNase_H1_N  
IPR020069  Ribosomal_L9_C  
IPR036791  Ribosomal_L9_C_sf  
IPR020070  Ribosomal_L9_N  
IPR036935  Ribosomal_L9_N_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0019843  F:rRNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF03948  Ribosomal_L9_C  
PF01281  Ribosomal_L9_N  
Amino Acid Sequences MASLLQSRVPSCLACLRRTTGSFGDGLLFSSSQQVRGKKKLAKEKDHNVTIQLLKPVIGIGRKGKIVQVPPGLMRNKLYGRGFVVYVTPTESEQAGSRKNVSLPDSTFGKRKAIRIEPVQDQKKALKFLSGERRLNLKKVVELELLSPERSTAILSDLIPPYIDFFETAITVAPLPVKKVSPSLASSSSISAAASKNSTGKSEKVPIYGSVSTADIAAKMKTILGQDSEGKRVVFGPEDIKFVQETEEKDRVKHLGIYEVDIQLRGAPEAVRRSIKINAQD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.35
4 0.39
5 0.41
6 0.43
7 0.37
8 0.35
9 0.31
10 0.28
11 0.26
12 0.2
13 0.2
14 0.16
15 0.13
16 0.11
17 0.18
18 0.18
19 0.21
20 0.27
21 0.33
22 0.38
23 0.46
24 0.54
25 0.53
26 0.61
27 0.67
28 0.71
29 0.75
30 0.77
31 0.8
32 0.81
33 0.8
34 0.72
35 0.63
36 0.58
37 0.51
38 0.44
39 0.37
40 0.27
41 0.23
42 0.22
43 0.2
44 0.17
45 0.16
46 0.16
47 0.18
48 0.21
49 0.22
50 0.22
51 0.24
52 0.27
53 0.28
54 0.32
55 0.31
56 0.3
57 0.31
58 0.37
59 0.36
60 0.32
61 0.3
62 0.29
63 0.27
64 0.32
65 0.31
66 0.26
67 0.27
68 0.27
69 0.26
70 0.21
71 0.2
72 0.14
73 0.13
74 0.13
75 0.11
76 0.09
77 0.1
78 0.1
79 0.09
80 0.11
81 0.14
82 0.15
83 0.16
84 0.18
85 0.18
86 0.19
87 0.22
88 0.22
89 0.22
90 0.21
91 0.23
92 0.25
93 0.25
94 0.27
95 0.26
96 0.3
97 0.28
98 0.31
99 0.35
100 0.36
101 0.4
102 0.41
103 0.45
104 0.46
105 0.53
106 0.53
107 0.46
108 0.43
109 0.42
110 0.4
111 0.38
112 0.31
113 0.25
114 0.22
115 0.28
116 0.37
117 0.4
118 0.38
119 0.36
120 0.44
121 0.42
122 0.43
123 0.39
124 0.29
125 0.23
126 0.24
127 0.26
128 0.19
129 0.18
130 0.17
131 0.18
132 0.18
133 0.16
134 0.13
135 0.11
136 0.1
137 0.1
138 0.09
139 0.05
140 0.06
141 0.07
142 0.08
143 0.11
144 0.11
145 0.11
146 0.11
147 0.1
148 0.1
149 0.09
150 0.09
151 0.06
152 0.06
153 0.06
154 0.06
155 0.07
156 0.05
157 0.05
158 0.05
159 0.05
160 0.07
161 0.07
162 0.08
163 0.1
164 0.1
165 0.11
166 0.13
167 0.15
168 0.16
169 0.18
170 0.2
171 0.21
172 0.22
173 0.22
174 0.2
175 0.19
176 0.16
177 0.14
178 0.12
179 0.1
180 0.1
181 0.1
182 0.1
183 0.13
184 0.13
185 0.16
186 0.17
187 0.19
188 0.23
189 0.29
190 0.3
191 0.3
192 0.3
193 0.29
194 0.32
195 0.3
196 0.26
197 0.19
198 0.18
199 0.16
200 0.15
201 0.13
202 0.08
203 0.09
204 0.08
205 0.08
206 0.07
207 0.07
208 0.09
209 0.11
210 0.11
211 0.12
212 0.15
213 0.21
214 0.23
215 0.26
216 0.26
217 0.25
218 0.23
219 0.23
220 0.22
221 0.17
222 0.17
223 0.2
224 0.19
225 0.23
226 0.23
227 0.23
228 0.21
229 0.19
230 0.21
231 0.19
232 0.22
233 0.26
234 0.34
235 0.33
236 0.34
237 0.37
238 0.36
239 0.35
240 0.35
241 0.29
242 0.29
243 0.29
244 0.32
245 0.32
246 0.33
247 0.3
248 0.26
249 0.25
250 0.19
251 0.19
252 0.15
253 0.13
254 0.11
255 0.17
256 0.22
257 0.27
258 0.29
259 0.3
260 0.33
261 0.38