Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8CIT2

Protein Details
Accession A0A4Y8CIT2    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MPKEKAPKRAAKKTEKKKKDPNAPKRGLSABasic
NLS Segment(s)
PositionSequence
3-26KEKAPKRAAKKTEKKKKDPNAPKR
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MPKEKAPKRAAKKTEKKKKDPNAPKRGLSAYMFFANEQRDNVREENPGISFGQVGKVLGERWKALNEKQRGPYEESAAKDKKRYEEEKASYNADAEEEESS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.91
3 0.91
4 0.91
5 0.92
6 0.92
7 0.92
8 0.92
9 0.92
10 0.88
11 0.8
12 0.74
13 0.66
14 0.58
15 0.49
16 0.4
17 0.32
18 0.27
19 0.25
20 0.21
21 0.21
22 0.2
23 0.19
24 0.17
25 0.16
26 0.15
27 0.18
28 0.19
29 0.18
30 0.17
31 0.17
32 0.17
33 0.16
34 0.16
35 0.13
36 0.12
37 0.1
38 0.08
39 0.09
40 0.07
41 0.07
42 0.06
43 0.07
44 0.07
45 0.1
46 0.11
47 0.1
48 0.12
49 0.15
50 0.17
51 0.22
52 0.3
53 0.33
54 0.39
55 0.44
56 0.49
57 0.49
58 0.52
59 0.49
60 0.46
61 0.45
62 0.41
63 0.42
64 0.42
65 0.41
66 0.4
67 0.42
68 0.43
69 0.48
70 0.51
71 0.51
72 0.56
73 0.59
74 0.61
75 0.61
76 0.57
77 0.49
78 0.44
79 0.36
80 0.26
81 0.22