Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Y8D585

Protein Details
Accession A0A4Y8D585    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
3-27ILTTIGSRRSRQRRTQYARKTYDRPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MVILTTIGSRRSRQRRTQYARKTYDRPGANTAAPPCSVTDDMNLPAYSYAPANGETVIAQQSSGIAQPAPAHVSKDVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.74
3 0.81
4 0.87
5 0.88
6 0.88
7 0.87
8 0.84
9 0.78
10 0.73
11 0.72
12 0.65
13 0.58
14 0.52
15 0.46
16 0.41
17 0.39
18 0.33
19 0.26
20 0.23
21 0.2
22 0.15
23 0.15
24 0.15
25 0.12
26 0.11
27 0.11
28 0.12
29 0.13
30 0.13
31 0.1
32 0.09
33 0.1
34 0.09
35 0.08
36 0.07
37 0.06
38 0.08
39 0.08
40 0.08
41 0.08
42 0.07
43 0.09
44 0.09
45 0.08
46 0.07
47 0.06
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.07
54 0.08
55 0.1
56 0.14
57 0.14
58 0.16