Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Z1L1H7

Protein Details
Accession A0A4Z1L1H7    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
143-200GWVYAMKAKRSRRKRGKGKGKEKEIVKETVKVKVKVKKRKHRKHKKHRKTEAETAGGSBasic
NLS Segment(s)
PositionSequence
149-191KAKRSRRKRGKGKGKEKEIVKETVKVKVKVKKRKHRKHKKHRK
Subcellular Location(s) mito 12.5, cyto_mito 8, extr 6, cyto 2.5, nucl 2, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAPLAFPILSSRSSPNKVANSTSQTIELFTQSSSAFSTYTPSPTQFPTPSTLPLESSIPTALPDLIREQFSTIIVDAPTTTYTSYIELNDNAFTYESASLPYSTPIGDSYAVETQAPQPNNSGRDIGIVIGCIIGVLILGLMGWVYAMKAKRSRRKRGKGKGKEKEIVKETVKVKVKVKKRKHRKHKKHRKTEAETAGGSGGVAPAAGGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.4
3 0.45
4 0.46
5 0.48
6 0.49
7 0.48
8 0.47
9 0.45
10 0.39
11 0.33
12 0.31
13 0.28
14 0.22
15 0.16
16 0.13
17 0.13
18 0.11
19 0.12
20 0.11
21 0.11
22 0.1
23 0.09
24 0.13
25 0.13
26 0.17
27 0.18
28 0.18
29 0.2
30 0.22
31 0.28
32 0.26
33 0.26
34 0.27
35 0.27
36 0.29
37 0.3
38 0.28
39 0.24
40 0.24
41 0.23
42 0.19
43 0.18
44 0.15
45 0.11
46 0.11
47 0.1
48 0.1
49 0.08
50 0.09
51 0.11
52 0.12
53 0.13
54 0.13
55 0.13
56 0.13
57 0.13
58 0.13
59 0.1
60 0.1
61 0.09
62 0.09
63 0.07
64 0.08
65 0.08
66 0.07
67 0.07
68 0.06
69 0.07
70 0.08
71 0.09
72 0.09
73 0.1
74 0.1
75 0.11
76 0.1
77 0.1
78 0.09
79 0.09
80 0.07
81 0.07
82 0.07
83 0.07
84 0.07
85 0.08
86 0.08
87 0.08
88 0.09
89 0.07
90 0.07
91 0.07
92 0.06
93 0.07
94 0.07
95 0.07
96 0.08
97 0.09
98 0.09
99 0.09
100 0.09
101 0.12
102 0.17
103 0.17
104 0.16
105 0.17
106 0.2
107 0.22
108 0.22
109 0.19
110 0.14
111 0.14
112 0.14
113 0.12
114 0.09
115 0.08
116 0.06
117 0.05
118 0.05
119 0.04
120 0.03
121 0.02
122 0.02
123 0.02
124 0.01
125 0.01
126 0.01
127 0.01
128 0.01
129 0.01
130 0.02
131 0.02
132 0.02
133 0.06
134 0.07
135 0.12
136 0.19
137 0.28
138 0.39
139 0.49
140 0.6
141 0.68
142 0.78
143 0.85
144 0.9
145 0.92
146 0.93
147 0.95
148 0.94
149 0.91
150 0.88
151 0.81
152 0.78
153 0.71
154 0.67
155 0.58
156 0.55
157 0.48
158 0.5
159 0.52
160 0.48
161 0.51
162 0.53
163 0.6
164 0.64
165 0.73
166 0.76
167 0.8
168 0.87
169 0.91
170 0.94
171 0.96
172 0.97
173 0.97
174 0.97
175 0.97
176 0.97
177 0.97
178 0.94
179 0.93
180 0.91
181 0.85
182 0.73
183 0.63
184 0.53
185 0.41
186 0.32
187 0.21
188 0.12
189 0.06
190 0.06